Os05t0127300-01

Locus

Os05g0127300

Description

Serine/threonine protein kinase domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsCRR3, CCR3

Oryzabase Gene Name Synonym(s)

CRINKLY4-RELATED protein 3

Transcript Evidence

AK121766 (DDBJ, Best hit)

Protein Evidence

B9FGM2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, active site (IPR008271)

Regulator of chromosome condensation/beta-lactamase-inhibitor protein II (IPR009091)

Protein kinase-like domain (IPR011009)

Concanavalin A-like lectin/glucanase, subgroup (IPR013320)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

Full-length cDNA

J033092A16 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0127300-01)

RiceXPro (AK121766)

Others

Oryzabase (10379)

KEGG (Os05t0127300-01)

Transcript

2479 bp

>Os05t0127300-01 Serine/threonine protein kinase domain containing protein.
AATCCGCGCCTTCCTCTCACAAGTCTCCTCTTCTTCTACGTACTCCTCTCCTTCCCCCGC
GCAGCCGTACACGACTCCCGATGAGATGACGGCCACCGCCGCCGTCGTCGCCGCCCGCCT
CATCCAATGACCCCGCTCCTCCTCCTCCTCCTCCTCCCCCTTCTCCTCCTCGCCCCGGCC
TCCGCCTCCACCGTCGCCATCGCCGCCGGCCCCACCGCCTGCGCCGTCGCGGAGGGAAAC
TCCACCGTCTACTGCGCCTCCGCCACCAACTCGTCCTCCTCCGCCGCCGTCGCGCCGTTC
GTCAGCTTCTCCCAGGTGTCCGGCGGCGGGGGGGCGTTCGTCTGCGGGCTGCAGGTCGGG
GGGCGCGCGCTCTTCTGCTGGCCCGCCGCGGCGCCGGGTCAGCTCAGGCGGGTGTACAAC
GGCCCGGGCCAGCTGTCACAGCTCGCCGTCGGGGGCGGCCATGTCGCGGCGTACGACGCC
GCGGCGCGGGTGATACGGTGGTGGCGTGGCGGGGACCGGTTCCCTCTCTGGTTCGGCGGT
GGGTTCGCCTCCCTCGTCTCCGGCGACGACTTCACCTGCGCCGTGGAGACGAGCACCTCC
GCCGTCCGGTGCTGGGGCCCGCGCGGCGGCGCCGTGGAGGCGGGTTTTCTCAACGCCTCC
GTCTCCGCCCTCGCCGCGGGAGGTTCCCGCGCGTGCGGGGTGAGGAGGAACGACGGCGGC
GTGCTCTGCTCCGGCGGTGGCGTGCTCGCGCCGCGCGAGGACCTGTACGTGGACGGCCTG
GCCGTCGGCGACTCCCACGCGTGCGGCCTCCTCCGGCCGAACCACACCGCCGCGTGCTGG
AGCCTCGGGGGCGCCACCACCACGCTCTACTACCCGGCGGTCGGCACGGCGTTCGAGCTC
CTCGTCGCCGGCGGTAACCTCACGTGCGGCCTCGTGTCGGCCAACTTCAGCCTGCTCTGC
TGGTCGAGGGATGGGTTGGTGGCGGCGGAGGTGAACCTGCCGCCGATCCTCCCCGGCGTC
TGCGTCTCCGACAACAGCTCGTGCAAATGCGGCCCGCTCCCGGACTCCGGGAGGTTCTGC
AAGGTCTCCGGCGGCGCCGCCGCAGCTGTCGGCAGTGGCGCGCCGAGCCCGTACGGGTCG
CCGAACGGGTCGCTCGGCCGCCTGCGGCGGCAGCTGTCGCGCGTGATGACGCGGCAGCGG
AGCGGGCCGTCGTCGTTCAAGGACCCCGCCGAGGAGTTCACCTTCGCGCAGCTCGCGGCG
GCGACCAAGGACTTCGCGGCGGAGGCCAAGATCGGGGAGGGGAGCTTCGGGACGGTGTAC
CGCGGCAAGCTCCCCGACGGGCGGGAGGTGGCCATCAAGCGCGGCGAGTCGGGGCCGCGC
GCGCGCAAGTTCCAGGAGAAGGAGACGGCGTTCCGGTCGGAGCTGGCCTTCCTCTCGCGG
CTCCACCACAAGCACCTCGTCGGCTTCGTCGGCTACTGCGAGGAGAGCGACGAGCGGCTG
CTGGTCTACGAGTACATGAAGAACGGCGCGCTCTACGACCACCTCCACCCCAAGCCCAAC
GGCTCGTCCTCGCCGTCCCCGTCGCCGGTGGCCACGTCGTGGAAGCTGCGCATCAAGATC
CTGCTCGACGCGTCGCGCGGCATCGActacctccactcgtacgccgtgccgccgatcatc
caccgcgacatcaagtcgtcgaacatcctgctcgacggcagctgggtggcgcgcgtgtcg
gacttcgggctgtcgctgatggggccggagacggaggaggtgaagcacctgtcgatgaag
gccgccgggacggtggggtacatggacccggagtactacggcctccaccacctcaccgtc
aagagcgacgtctacggcttcggcgtcgtcatgctcgaggcgctcaccgggaagcgcgcc
ATCTTCAAGGAGGCCGAGGGCGGGAGCCCCGTCAGCGTGGTGGACTACGCCGTCCCCAGC
ATCGTCGCCGGCGAGCTCAGCAAGGTGCTCGACGCCCGCGCGCCGGAGCCGAGCGCGCAC
GAGGCCGAGGCCGTCGAGCTGGTCGCCTACACGGCGGTGCACTGCGTCCGGCTGGAGGGG
AAGGACCGGCCGGCGATGGCGGACATCGTGGCCAACCTCGAGACGGCGGTGGCGCTCTGC
GAGGACAGCGCCACCGGCGGCGGCGCCGCCGGCCATGGCAACAGCTCGTCCAGCGCCAGC
CTCTCCATCACGTCCATGGAGTTGAGTAGGATGGATTGATTGAGATTAGTAGCTTCCCTA
ATTCAAATCCAGAGTTTCAAATTGTGATTAGCCCCGGAAGGAGATTTTAAAATTTGTTGC
TTCACTTCATTTTTTTTAGAGGAGAACATCATTTGTGTGATTCTCTCACACATTTTGTTC
ATGGTGGCTGTACATGATTTTGTATTGAACTGATTTCTCTTTTCATAGATGAGAAAATTT
CTCTCTTTTTTTTTCTACT

CDS

2133 bp

>Os05t0127300-01 Serine/threonine protein kinase domain containing protein.
ATGACCCCGCTCCTCCTCCTCCTCCTCCTCCCCCTTCTCCTCCTCGCCCCGGCCTCCGCC
TCCACCGTCGCCATCGCCGCCGGCCCCACCGCCTGCGCCGTCGCGGAGGGAAACTCCACC
GTCTACTGCGCCTCCGCCACCAACTCGTCCTCCTCCGCCGCCGTCGCGCCGTTCGTCAGC
TTCTCCCAGGTGTCCGGCGGCGGGGGGGCGTTCGTCTGCGGGCTGCAGGTCGGGGGGCGC
GCGCTCTTCTGCTGGCCCGCCGCGGCGCCGGGTCAGCTCAGGCGGGTGTACAACGGCCCG
GGCCAGCTGTCACAGCTCGCCGTCGGGGGCGGCCATGTCGCGGCGTACGACGCCGCGGCG
CGGGTGATACGGTGGTGGCGTGGCGGGGACCGGTTCCCTCTCTGGTTCGGCGGTGGGTTC
GCCTCCCTCGTCTCCGGCGACGACTTCACCTGCGCCGTGGAGACGAGCACCTCCGCCGTC
CGGTGCTGGGGCCCGCGCGGCGGCGCCGTGGAGGCGGGTTTTCTCAACGCCTCCGTCTCC
GCCCTCGCCGCGGGAGGTTCCCGCGCGTGCGGGGTGAGGAGGAACGACGGCGGCGTGCTC
TGCTCCGGCGGTGGCGTGCTCGCGCCGCGCGAGGACCTGTACGTGGACGGCCTGGCCGTC
GGCGACTCCCACGCGTGCGGCCTCCTCCGGCCGAACCACACCGCCGCGTGCTGGAGCCTC
GGGGGCGCCACCACCACGCTCTACTACCCGGCGGTCGGCACGGCGTTCGAGCTCCTCGTC
GCCGGCGGTAACCTCACGTGCGGCCTCGTGTCGGCCAACTTCAGCCTGCTCTGCTGGTCG
AGGGATGGGTTGGTGGCGGCGGAGGTGAACCTGCCGCCGATCCTCCCCGGCGTCTGCGTC
TCCGACAACAGCTCGTGCAAATGCGGCCCGCTCCCGGACTCCGGGAGGTTCTGCAAGGTC
TCCGGCGGCGCCGCCGCAGCTGTCGGCAGTGGCGCGCCGAGCCCGTACGGGTCGCCGAAC
GGGTCGCTCGGCCGCCTGCGGCGGCAGCTGTCGCGCGTGATGACGCGGCAGCGGAGCGGG
CCGTCGTCGTTCAAGGACCCCGCCGAGGAGTTCACCTTCGCGCAGCTCGCGGCGGCGACC
AAGGACTTCGCGGCGGAGGCCAAGATCGGGGAGGGGAGCTTCGGGACGGTGTACCGCGGC
AAGCTCCCCGACGGGCGGGAGGTGGCCATCAAGCGCGGCGAGTCGGGGCCGCGCGCGCGC
AAGTTCCAGGAGAAGGAGACGGCGTTCCGGTCGGAGCTGGCCTTCCTCTCGCGGCTCCAC
CACAAGCACCTCGTCGGCTTCGTCGGCTACTGCGAGGAGAGCGACGAGCGGCTGCTGGTC
TACGAGTACATGAAGAACGGCGCGCTCTACGACCACCTCCACCCCAAGCCCAACGGCTCG
TCCTCGCCGTCCCCGTCGCCGGTGGCCACGTCGTGGAAGCTGCGCATCAAGATCCTGCTC
GACGCGTCGCGCGGCATCGActacctccactcgtacgccgtgccgccgatcatccaccgc
gacatcaagtcgtcgaacatcctgctcgacggcagctgggtggcgcgcgtgtcggacttc
gggctgtcgctgatggggccggagacggaggaggtgaagcacctgtcgatgaaggccgcc
gggacggtggggtacatggacccggagtactacggcctccaccacctcaccgtcaagagc
gacgtctacggcttcggcgtcgtcatgctcgaggcgctcaccgggaagcgcgccATCTTC
AAGGAGGCCGAGGGCGGGAGCCCCGTCAGCGTGGTGGACTACGCCGTCCCCAGCATCGTC
GCCGGCGAGCTCAGCAAGGTGCTCGACGCCCGCGCGCCGGAGCCGAGCGCGCACGAGGCC
GAGGCCGTCGAGCTGGTCGCCTACACGGCGGTGCACTGCGTCCGGCTGGAGGGGAAGGAC
CGGCCGGCGATGGCGGACATCGTGGCCAACCTCGAGACGGCGGTGGCGCTCTGCGAGGAC
AGCGCCACCGGCGGCGGCGCCGCCGGCCATGGCAACAGCTCGTCCAGCGCCAGCCTCTCC
ATCACGTCCATGGAGTTGAGTAGGATGGATTGA

Protein

711 aa

>Os05t0127300-01 Serine/threonine protein kinase domain containing protein.
MTPLLLLLLLPLLLLAPASASTVAIAAGPTACAVAEGNSTVYCASATNSSSSAAVAPFVS
FSQVSGGGGAFVCGLQVGGRALFCWPAAAPGQLRRVYNGPGQLSQLAVGGGHVAAYDAAA
RVIRWWRGGDRFPLWFGGGFASLVSGDDFTCAVETSTSAVRCWGPRGGAVEAGFLNASVS
ALAAGGSRACGVRRNDGGVLCSGGGVLAPREDLYVDGLAVGDSHACGLLRPNHTAACWSL
GGATTTLYYPAVGTAFELLVAGGNLTCGLVSANFSLLCWSRDGLVAAEVNLPPILPGVCV
SDNSSCKCGPLPDSGRFCKVSGGAAAAVGSGAPSPYGSPNGSLGRLRRQLSRVMTRQRSG
PSSFKDPAEEFTFAQLAAATKDFAAEAKIGEGSFGTVYRGKLPDGREVAIKRGESGPRAR
KFQEKETAFRSELAFLSRLHHKHLVGFVGYCEESDERLLVYEYMKNGALYDHLHPKPNGS
SSPSPSPVATSWKLRIKILLDASRGIDYLHSYAVPPIIHRDIKSSNILLDGSWVARVSDF
GLSLMGPETEEVKHLSMKAAGTVGYMDPEYYGLHHLTVKSDVYGFGVVMLEALTGKRAIF
KEAEGGSPVSVVDYAVPSIVAGELSKVLDARAPEPSAHEAEAVELVAYTAVHCVRLEGKD
RPAMADIVANLETAVALCEDSATGGGAAGHGNSSSSASLSITSMELSRMD*

5'UTR

chr05:1547307..1547432 (+ strand) : 126 bp

CDS

chr05:1547433..1548394 (+ strand) : 962 bp

chr05:1548659..1549829 (+ strand) : 1171 bp

3'UTR

chr05:1549830..1550049 (+ strand) : 220 bp

FASTA

>Os05t0127300-01 class=Sequence position=chr05:1547307..1550049 (+ strand)
AATCCGCGCC TTCCTCTCAC AAGTCTCCTC TTCTTCTACG TACTCCTCTC CTTCCCCCGC GCAGCCGTAC ACGACTCCCG
ATGAGATGAC GGCCACCGCC GCCGTCGTCG CCGCCCGCCT CATCCAATGA CCCCGCTCCT CCTCCTCCTC CTCCTCCCCC
TTCTCCTCCT CGCCCCGGCC TCCGCCTCCA CCGTCGCCAT CGCCGCCGGC CCCACCGCCT GCGCCGTCGC GGAGGGAAAC
TCCACCGTCT ACTGCGCCTC CGCCACCAAC TCGTCCTCCT CCGCCGCCGT CGCGCCGTTC GTCAGCTTCT CCCAGGTGTC
CGGCGGCGGG GGGGCGTTCG TCTGCGGGCT GCAGGTCGGG GGGCGCGCGC TCTTCTGCTG GCCCGCCGCG GCGCCGGGTC
AGCTCAGGCG GGTGTACAAC GGCCCGGGCC AGCTGTCACA GCTCGCCGTC GGGGGCGGCC ATGTCGCGGC GTACGACGCC
GCGGCGCGGG TGATACGGTG GTGGCGTGGC GGGGACCGGT TCCCTCTCTG GTTCGGCGGT GGGTTCGCCT CCCTCGTCTC
CGGCGACGAC TTCACCTGCG CCGTGGAGAC GAGCACCTCC GCCGTCCGGT GCTGGGGCCC GCGCGGCGGC GCCGTGGAGG
CGGGTTTTCT CAACGCCTCC GTCTCCGCCC TCGCCGCGGG AGGTTCCCGC GCGTGCGGGG TGAGGAGGAA CGACGGCGGC
GTGCTCTGCT CCGGCGGTGG CGTGCTCGCG CCGCGCGAGG ACCTGTACGT GGACGGCCTG GCCGTCGGCG ACTCCCACGC
GTGCGGCCTC CTCCGGCCGA ACCACACCGC CGCGTGCTGG AGCCTCGGGG GCGCCACCAC CACGCTCTAC TACCCGGCGG
TCGGCACGGC GTTCGAGCTC CTCGTCGCCG GCGGTAACCT CACGTGCGGC CTCGTGTCGG CCAACTTCAG CCTGCTCTGC
TGGTCGAGGG ATGGGTTGGT GGCGGCGGAG GTGAACCTGC CGCCGATCCT CCCCGGCGTC TGCGTCTCCG ACAACAGCTC
GTGCAAATGC GGCCCGCTCC CGGACTCCGG GAGGTTCTGC AAGGTCTCCG GCGACGTCAT CTGCAGAAGG TTCTGTGACA
CGTCGCCGCC GCCGCCGCCG CCGTCTCCTC GTACGCCGTC GCCGCCGGCG ACCCCGAGCT CGAGACGCGG CGTGTCCAAA
GGCTGGATCG CGTTCGCCGT CGTCGGCGCG GTGGGCTGCT TCGCGGGGCT CTGCTCCATC GTCTACTGCC TCCTCTTCGG
CTTCTGCAGC CACAAGAAGG TGCACAACTC TGTCCAGCCC AACATCGCCA GCAACAACAA CGGCGGCGGC GGCGGCGGCG
CCGCCGCAGC TGTCGGCAGT GGCGCGCCGA GCCCGTACGG GTCGCCGAAC GGGTCGCTCG GCCGCCTGCG GCGGCAGCTG
TCGCGCGTGA TGACGCGGCA GCGGAGCGGG CCGTCGTCGT TCAAGGACCC CGCCGAGGAG TTCACCTTCG CGCAGCTCGC
GGCGGCGACC AAGGACTTCG CGGCGGAGGC CAAGATCGGG GAGGGGAGCT TCGGGACGGT GTACCGCGGC AAGCTCCCCG
ACGGGCGGGA GGTGGCCATC AAGCGCGGCG AGTCGGGGCC GCGCGCGCGC AAGTTCCAGG AGAAGGAGAC GGCGTTCCGG
TCGGAGCTGG CCTTCCTCTC GCGGCTCCAC CACAAGCACC TCGTCGGCTT CGTCGGCTAC TGCGAGGAGA GCGACGAGCG
GCTGCTGGTC TACGAGTACA TGAAGAACGG CGCGCTCTAC GACCACCTCC ACCCCAAGCC CAACGGCTCG TCCTCGCCGT
CCCCGTCGCC GGTGGCCACG TCGTGGAAGC TGCGCATCAA GATCCTGCTC GACGCGTCGC GCGGCATCGA ctacctccac
tcgtacgccg tgccgccgat catccaccgc gacatcaagt cgtcgaacat cctgctcgac ggcagctggg tggcgcgcgt
gtcggacttc gggctgtcgc tgatggggcc ggagacggag gaggtgaagc acctgtcgat gaaggccgcc gggacggtgg
ggtacatgga cccggagtac tacggcctcc accacctcac cgtcaagagc gacgtctacg gcttcggcgt cgtcatgctc
gaggcgctca ccgggaagcg cgccATCTTC AAGGAGGCCG AGGGCGGGAG CCCCGTCAGC GTGGTGGACT ACGCCGTCCC
CAGCATCGTC GCCGGCGAGC TCAGCAAGGT GCTCGACGCC CGCGCGCCGG AGCCGAGCGC GCACGAGGCC GAGGCCGTCG
AGCTGGTCGC CTACACGGCG GTGCACTGCG TCCGGCTGGA GGGGAAGGAC CGGCCGGCGA TGGCGGACAT CGTGGCCAAC
CTCGAGACGG CGGTGGCGCT CTGCGAGGAC AGCGCCACCG GCGGCGGCGC CGCCGGCCAT GGCAACAGCT CGTCCAGCGC
CAGCCTCTCC ATCACGTCCA TGGAGTTGAG TAGGATGGAT TGATTGAGAT TAGTAGCTTC CCTAATTCAA ATCCAGAGTT
TCAAATTGTG ATTAGCCCCG GAAGGAGATT TTAAAATTTG TTGCTTCACT TCATTTTTTT TAGAGGAGAA CATCATTTGT
GTGATTCTCT CACACATTTT GTTCATGGTG GCTGTACATG ATTTTGTATT GAACTGATTT CTCTTTTCAT AGATGAGAAA
ATTTCTCTCT TTTTTTTTCT ACT

Locus: Os05g0127300

Loading...

Locus: Os05g0127300

Loading...