Os05t0127300-02

Locus

Os05g0127300

Description

Regulator of chromosome condensation/beta-lactamase-inhibitor protein II domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsCRR3, CCR3

Oryzabase Gene Name Synonym(s)

CRINKLY4-RELATED protein 3

Transcript Evidence

AK106429 (DDBJ, Best hit)

Protein Evidence

B9FGM2 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Functional domain (InterPro)

Regulator of chromosome condensation/beta-lactamase-inhibitor protein II (IPR009091)

Full-length cDNA

002-103-C01 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0127300-02)

Others

Oryzabase (10379)

Transcript

2042 bp

>Os05t0127300-02 Regulator of chromosome condensation/beta-lactamase-inhibitor protein II domain containing protein.
CTCCTCCTCCCCCTTCTCCTCCTCGCCCCGGCCTCCGCCTCCACCGTCGCCATCGCCGCC
GGCCCCACCGCCTGCGCCGTCGCGGAGGGAAACTCCACCGTCTACTGCGCCTCCGCCACC
AACTCGTCCTCCTCCGCCGCCGTCGCGCCGTTCGTCAGCTTCTCCCAGGTGTCCGGCGGC
GGGGGGGCGTTCGTCTGCGGGCTGCAGGTCGGGGGGCGCGCGCTCTTCTGCTGGCCCGCC
GCGGCGCCGGGTCAGCTCAGGCGGGTGTACAACGGCCCGGGCCAGCTGTCACAGCTCGCC
GTCGGGGGCGGCCATGTCGCGGCGTACGACGCCGCGGCGCGGGTGATACGGTGGTGGCGT
GGCGGGGACCGGTTCCCTCTCTGGTTCGGCGGTGGGTTCGCCTCCCTCGTCTCCGGCGAC
GACTTCACCTGCGCCGTGGAGACGAGCACCTCCGCCGTCCGGTGCTGGGGCCCGCGCGGC
GGCGCCGTGGAGGCGGGTTTTCTCAACGCCTCCGTCTCCGCCCTCGCCGCGGGAGGTTCC
CGCGCGTGCGGGGTGAGGAGGAACGACGGCGGCGTGCTCTGCTCCGGCGGTGGCGTGCTC
GCGCCGCGCGAGGACCTGTACGTGGACGGCCTGGCCGTCGGCGACTCCCACGCGTGCGGC
CTCCTCCGGCCGAACCACACCGCCGCGTGCTGGAGCCTCGGGGGCGCCACCACCACGCTC
TACTACCCGGCGGTCGGCACGGCGTTCGAGCTCCTCGTCGCCGGCGGTAACCTCACGTGC
GGCCTCGTGTCGGCCAACTTCAGCCTGCTCTGCTGGTCGAGGGATGGGTTGGTGGCGGCG
GAGGTGAACCTGCCGCCGATCCTCCCCGGCGTCTGCGTCTCCGACAACAGCTCGTGCAAA
TGCGGCCCGCTCCCGGACTCCGGGAGGTTCTGCAAGGTCTCCGGCGACGTCATCTGCAGA
AGGTTCTGTGACACGTCGCCGCCGCCGCCGCCGCCGTCTCCTCGTACGCCGTCGCCGCCG
GCGACCCCGAGCTCGAGACGCGGCGTGTCCAAAGGCTGGATCGCGTTCGCCGTCGTCGGC
GCGGTGGGCTGCTTCGCGGGGCTCTGCTCCATCGTCTACTGCCTCCTCTTCGGCTTCTGC
AGCCACAAGAAGGTGCACAACTCTGTCCAGCCCAACATCGCCGGTGGCCACGTCGTGGAA
GCTGCGCATCAAGATCCTGCTCGACGCGTCGCGCGGCATCGActacctccactcgtacgc
cgtgccgccgatcatccaccgcgacatcaagtcgtcgaacatcctgctcgacggcagctg
ggtggcgcgcgtgtcggacttcgggctgtcgctgatggggccggagacggaggaggtgaa
gcacctgtcgatgaaggccgccgggacggtggggtacatggacccggagtactacggcct
ccaccacctcaccgtcaagagcgacgtctacggcttcggcgtcgtcatgctcgaggcgct
caccgggaagcgcgccATCTTCAAGGAGGCCGAGGGCGGGAGCCCCGTCAGCGTGGTGGA
CTACGCCGTCCCCAGCATCGTCGCCGGCGAGCTCAGCAAGGTGCTCGACGCCCGCGCGCC
GGAGCCGAGCGCGCACGAGGCCGAGGCCGTCGAGCTGGTCGCCTACACGGCGGTGCACTG
CGTCCGGCTGGAGGGGAAGGACCGGCCGGCGATGGCGGACATCGTGGCCAACCTCGAGAC
GGCGGTGGCGCTCTGCGAGGACAGCGCCACCGGCGGCGGCGCCGCCGGCCATGGCAACAG
CTCGTCCAGCGCCAGCCTCTCCATCACGTCCATGGAGTTGAGTAGGATGGATTGATTGAG
ATTAGTAGCTTCCCTAATTCAAATCCAGAGTTTCAAATTGTGATTAGCCCCGGAAGGAGA
TTTTAAAATTTGTTGCTTCACTTCATTTTTTTTAGAGGAGAACATCATTTGTGTGATTCT
CTCACACATTTTGTTCATGGTGGCTGTACATGATTTTGTATTGAACTGATTTCTCTTTTC
AT

CDS

1845 bp

>Os05t0127300-02 Regulator of chromosome condensation/beta-lactamase-inhibitor protein II domain containing protein.
CTCCTCCTCCCCCTTCTCCTCCTCGCCCCGGCCTCCGCCTCCACCGTCGCCATCGCCGCC
GGCCCCACCGCCTGCGCCGTCGCGGAGGGAAACTCCACCGTCTACTGCGCCTCCGCCACC
AACTCGTCCTCCTCCGCCGCCGTCGCGCCGTTCGTCAGCTTCTCCCAGGTGTCCGGCGGC
GGGGGGGCGTTCGTCTGCGGGCTGCAGGTCGGGGGGCGCGCGCTCTTCTGCTGGCCCGCC
GCGGCGCCGGGTCAGCTCAGGCGGGTGTACAACGGCCCGGGCCAGCTGTCACAGCTCGCC
GTCGGGGGCGGCCATGTCGCGGCGTACGACGCCGCGGCGCGGGTGATACGGTGGTGGCGT
GGCGGGGACCGGTTCCCTCTCTGGTTCGGCGGTGGGTTCGCCTCCCTCGTCTCCGGCGAC
GACTTCACCTGCGCCGTGGAGACGAGCACCTCCGCCGTCCGGTGCTGGGGCCCGCGCGGC
GGCGCCGTGGAGGCGGGTTTTCTCAACGCCTCCGTCTCCGCCCTCGCCGCGGGAGGTTCC
CGCGCGTGCGGGGTGAGGAGGAACGACGGCGGCGTGCTCTGCTCCGGCGGTGGCGTGCTC
GCGCCGCGCGAGGACCTGTACGTGGACGGCCTGGCCGTCGGCGACTCCCACGCGTGCGGC
CTCCTCCGGCCGAACCACACCGCCGCGTGCTGGAGCCTCGGGGGCGCCACCACCACGCTC
TACTACCCGGCGGTCGGCACGGCGTTCGAGCTCCTCGTCGCCGGCGGTAACCTCACGTGC
GGCCTCGTGTCGGCCAACTTCAGCCTGCTCTGCTGGTCGAGGGATGGGTTGGTGGCGGCG
GAGGTGAACCTGCCGCCGATCCTCCCCGGCGTCTGCGTCTCCGACAACAGCTCGTGCAAA
TGCGGCCCGCTCCCGGACTCCGGGAGGTTCTGCAAGGTCTCCGGCGACGTCATCTGCAGA
AGGTTCTGTGACACGTCGCCGCCGCCGCCGCCGCCGTCTCCTCGTACGCCGTCGCCGCCG
GCGACCCCGAGCTCGAGACGCGGCGTGTCCAAAGGCTGGATCGCGTTCGCCGTCGTCGGC
GCGGTGGGCTGCTTCGCGGGGCTCTGCTCCATCGTCTACTGCCTCCTCTTCGGCTTCTGC
AGCCACAAGAAGGTGCACAACTCTGTCCAGCCCAACATCGCCGGTGGCCACGTCGTGGAA
GCTGCGCATCAAGATCCTGCTCGACGCGTCGCGCGGCATCGActacctccactcgtacgc
cgtgccgccgatcatccaccgcgacatcaagtcgtcgaacatcctgctcgacggcagctg
ggtggcgcgcgtgtcggacttcgggctgtcgctgatggggccggagacggaggaggtgaa
gcacctgtcgatgaaggccgccgggacggtggggtacatggacccggagtactacggcct
ccaccacctcaccgtcaagagcgacgtctacggcttcggcgtcgtcatgctcgaggcgct
caccgggaagcgcgccATCTTCAAGGAGGCCGAGGGCGGGAGCCCCGTCAGCGTGGTGGA
CTACGCCGTCCCCAGCATCGTCGCCGGCGAGCTCAGCAAGGTGCTCGACGCCCGCGCGCC
GGAGCCGAGCGCGCACGAGGCCGAGGCCGTCGAGCTGGTCGCCTACACGGCGGTGCACTG
CGTCCGGCTGGAGGGGAAGGACCGGCCGGCGATGGCGGACATCGTGGCCAACCTCGAGAC
GGCGGTGGCGCTCTGCGAGGACAGCGCCACCGGCGGCGGCGCCGCCGGCCATGGCAACAG
CTCGTCCAGCGCCAGCCTCTCCATCACGTCCATGGAGTTGAGTAG

Protein

615 aa

>Os05t0127300-02 Regulator of chromosome condensation/beta-lactamase-inhibitor protein II domain containing protein.
LLLPLLLLAPASASTVAIAAGPTACAVAEGNSTVYCASATNSSSSAAVAPFVSFSQVSGG
GGAFVCGLQVGGRALFCWPAAAPGQLRRVYNGPGQLSQLAVGGGHVAAYDAAARVIRWWR
GGDRFPLWFGGGFASLVSGDDFTCAVETSTSAVRCWGPRGGAVEAGFLNASVSALAAGGS
RACGVRRNDGGVLCSGGGVLAPREDLYVDGLAVGDSHACGLLRPNHTAACWSLGGATTTL
YYPAVGTAFELLVAGGNLTCGLVSANFSLLCWSRDGLVAAEVNLPPILPGVCVSDNSSCK
CGPLPDSGRFCKVSGDVICRRFCDTSPPPPPPSPRTPSPPATPSSRRGVSKGWIAFAVVG
AVGCFAGLCSIVYCLLFGFCSHKKVHNSVQPNIAGGHVVEAAHQDPARRVARHRLPPLVR
RAADHPPRHQVVEHPARRQLGGARVGLRAVADGAGDGGGEAPVDEGRRDGGVHGPGVLRP
PPPHRQERRLRLRRRHARGAHREARHLQGGRGREPRQRGGLRRPQHRRRRAQQGARRPRA
GAERARGRGRRAGRLHGGALRPAGGEGPAGDGGHRGQPRDGGGALRGQRHRRRRRRPWQQ
LVQRQPLHHVHGVE*

CDS

chr05:1547454..1548630 (+ strand) : 1177 bp

chr05:1549152..1549819 (+ strand) : 668 bp

3'UTR

chr05:1549820..1550016 (+ strand) : 197 bp

FASTA

>Os05t0127300-02 class=Sequence position=chr05:1547454..1550016 (+ strand)
CTCCTCCTCC CCCTTCTCCT CCTCGCCCCG GCCTCCGCCT CCACCGTCGC CATCGCCGCC GGCCCCACCG CCTGCGCCGT
CGCGGAGGGA AACTCCACCG TCTACTGCGC CTCCGCCACC AACTCGTCCT CCTCCGCCGC CGTCGCGCCG TTCGTCAGCT
TCTCCCAGGT GTCCGGCGGC GGGGGGGCGT TCGTCTGCGG GCTGCAGGTC GGGGGGCGCG CGCTCTTCTG CTGGCCCGCC
GCGGCGCCGG GTCAGCTCAG GCGGGTGTAC AACGGCCCGG GCCAGCTGTC ACAGCTCGCC GTCGGGGGCG GCCATGTCGC
GGCGTACGAC GCCGCGGCGC GGGTGATACG GTGGTGGCGT GGCGGGGACC GGTTCCCTCT CTGGTTCGGC GGTGGGTTCG
CCTCCCTCGT CTCCGGCGAC GACTTCACCT GCGCCGTGGA GACGAGCACC TCCGCCGTCC GGTGCTGGGG CCCGCGCGGC
GGCGCCGTGG AGGCGGGTTT TCTCAACGCC TCCGTCTCCG CCCTCGCCGC GGGAGGTTCC CGCGCGTGCG GGGTGAGGAG
GAACGACGGC GGCGTGCTCT GCTCCGGCGG TGGCGTGCTC GCGCCGCGCG AGGACCTGTA CGTGGACGGC CTGGCCGTCG
GCGACTCCCA CGCGTGCGGC CTCCTCCGGC CGAACCACAC CGCCGCGTGC TGGAGCCTCG GGGGCGCCAC CACCACGCTC
TACTACCCGG CGGTCGGCAC GGCGTTCGAG CTCCTCGTCG CCGGCGGTAA CCTCACGTGC GGCCTCGTGT CGGCCAACTT
CAGCCTGCTC TGCTGGTCGA GGGATGGGTT GGTGGCGGCG GAGGTGAACC TGCCGCCGAT CCTCCCCGGC GTCTGCGTCT
CCGACAACAG CTCGTGCAAA TGCGGCCCGC TCCCGGACTC CGGGAGGTTC TGCAAGGTCT CCGGCGACGT CATCTGCAGA
AGGTTCTGTG ACACGTCGCC GCCGCCGCCG CCGCCGTCTC CTCGTACGCC GTCGCCGCCG GCGACCCCGA GCTCGAGACG
CGGCGTGTCC AAAGGCTGGA TCGCGTTCGC CGTCGTCGGC GCGGTGGGCT GCTTCGCGGG GCTCTGCTCC ATCGTCTACT
GCCTCCTCTT CGGCTTCTGC AGCCACAAGA AGGTGCACAA CTCTGTCCAG CCCAACATCG CCAGCAACAA CAACGGCGGC
GGCGGCGGCG GCGCCGCCGC AGCTGTCGGC AGTGGCGCGC CGAGCCCGTA CGGGTCGCCG AACGGGTCGC TCGGCCGCCT
GCGGCGGCAG CTGTCGCGCG TGATGACGCG GCAGCGGAGC GGGCCGTCGT CGTTCAAGGA CCCCGCCGAG GAGTTCACCT
TCGCGCAGCT CGCGGCGGCG ACCAAGGACT TCGCGGCGGA GGCCAAGATC GGGGAGGGGA GCTTCGGGAC GGTGTACCGC
GGCAAGCTCC CCGACGGGCG GGAGGTGGCC ATCAAGCGCG GCGAGTCGGG GCCGCGCGCG CGCAAGTTCC AGGAGAAGGA
GACGGCGTTC CGGTCGGAGC TGGCCTTCCT CTCGCGGCTC CACCACAAGC ACCTCGTCGG CTTCGTCGGC TACTGCGAGG
AGAGCGACGA GCGGCTGCTG GTCTACGAGT ACATGAAGAA CGGCGCGCTC TACGACCACC TCCACCCCAA GCCCAACGGC
TCGTCCTCGC CGTCCCCGTC GCCGGTGGCC ACGTCGTGGA AGCTGCGCAT CAAGATCCTG CTCGACGCGT CGCGCGGCAT
CGActacctc cactcgtacg ccgtgccgcc gatcatccac cgcgacatca agtcgtcgaa catcctgctc gacggcagct
gggtggcgcg cgtgtcggac ttcgggctgt cgctgatggg gccggagacg gaggaggtga agcacctgtc gatgaaggcc
gccgggacgg tggggtacat ggacccggag tactacggcc tccaccacct caccgtcaag agcgacgtct acggcttcgg
cgtcgtcatg ctcgaggcgc tcaccgggaa gcgcgccATC TTCAAGGAGG CCGAGGGCGG GAGCCCCGTC AGCGTGGTGG
ACTACGCCGT CCCCAGCATC GTCGCCGGCG AGCTCAGCAA GGTGCTCGAC GCCCGCGCGC CGGAGCCGAG CGCGCACGAG
GCCGAGGCCG TCGAGCTGGT CGCCTACACG GCGGTGCACT GCGTCCGGCT GGAGGGGAAG GACCGGCCGG CGATGGCGGA
CATCGTGGCC AACCTCGAGA CGGCGGTGGC GCTCTGCGAG GACAGCGCCA CCGGCGGCGG CGCCGCCGGC CATGGCAACA
GCTCGTCCAG CGCCAGCCTC TCCATCACGT CCATGGAGTT GAGTAGGATG GATTGATTGA GATTAGTAGC TTCCCTAATT
CAAATCCAGA GTTTCAAATT GTGATTAGCC CCGGAAGGAG ATTTTAAAAT TTGTTGCTTC ACTTCATTTT TTTTAGAGGA
GAACATCATT TGTGTGATTC TCTCACACAT TTTGTTCATG GTGGCTGTAC ATGATTTTGT ATTGAACTGA TTTCTCTTTT
CAT

Locus: Os05g0127300

Loading...

Locus: Os05g0127300

Loading...