Os05t0127400-01

Locus

Os05g0127400

Description

Similar to DnaJ subfamily B member 13.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDjB5

Oryzabase Gene Name Synonym(s)

DnaJ domain protein B5

Transcript Evidence

AK069823 (DDBJ, Best hit)

Protein Evidence

B6TKS5 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: heat shock protein binding (GO:0031072)

Functional domain (InterPro)

Heat shock protein DnaJ, N-terminal (IPR001623)

Full-length cDNA

J023029N24 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0127400-01)

Others

Oryzabase (12154)

Transcript

1192 bp

>Os05t0127400-01 Similar to DnaJ subfamily B member 13.
ACTACAAATTTATCTTTTCTCGAACGAAAAAAAAAAGCGATAAAAACCATCTCATCGAGG
AAGAAAGCAACCCACGATAACCCTCTTCTTCTTCTACCCATCTCGCCGTCGCCGCCGCCG
CCGCCGCCGCCGCCGTCGAATCGATCGAAGCCCAGCAGCGAGCGATGGGGCTGGACTACT
ACAAGGTGCTCGGCGTGGGCCGCGGCGCCACCGACGAGGAGCTCAAGAGATCCTACCGCC
GCCTCGCGACAAGAACCGCTCGCCGCACGCCGACGACTCCCTCTTCAAGCAAGCCGGCGC
GGCGCCGCCGCCGACCACCTCCTCCTCCTCCTCCCACGGCGGCGGAGGAGGCTTCCGCTT
CAGCCCGAGGAGCGCCGAGGAGATCTTCTCGGAGATGTTCGGGGGCGCATTCGGCGGCGC
GGGGCCACGCGCCCCCGGCGCCGGGTTCCCGGGGTTCGGTGGGTCCCCCCGGGCAGGGGA
GACGTCGGCGACGAAAGCTCCGGCGATCGAGCGGCAGCTGGCTTGCAGCCTTGAGGACCT
CTACAGGGGCGCCACCAAGAAGATGAAGATCTCTAGGGATGTCCTCGACGCCACTGGGAA
ACCGACAAATCTGGAGGAGATCCTGACAATCGATATCAAGCCTGGATGGAAGAAGGGTAC
AAAGGTAACCTTTCCCAAGAAAGGCAATGAGAAGCCTAACATCATACCATCAGACCTAGT
GTTTATAATAGAAGAGCGGTCGCACGCTAGATTCAAGCGAGACAAGGATGATCTTATTTA
CACGCATAGGATCTCGCTCGTGGAGGCTTTGACCGGTTGCACAGTCCAACTGACAACTCT
GGATGGGCGGAATTTAACCGTTCCAGTGAAGTCCGTCATCAATCCTACTTCTGAAGAGGT
TGTGAAGGGCGAAGGGATGCCAATCACAAAGGAACCGTCTAAGAAAGGGGATCTGAAGAT
CAGGTTTCAGATCAAGTTCCCCACCAATCTAACGTCTGACCAAAAGTCAGGGATCCAGCA
ACTTTTGCCTAAGCCTTAACTGGTAGTACAATATTGTGAACCTGTATTTAGTCGTTTGTT
TAGCAGTTGGGAATACATTGAGAGGGTTTGATCACAGTTGCTGAATGTACAATCACTGCT
TCGGTGCAAGTATTGAAGAACATGTTTGCATTGGTATTTCCAACATTACTCC

CDS

402 bp

>Os05t0127400-01 Similar to DnaJ subfamily B member 13.
ATGGGGCTGGACTACTACAAGGTGCTCGGCGTGGGCCGCGGCGCCACCGACGAGGAGCTC
AAGAGATCCTACCGCCGCCTCGCGACAAGAACCGCTCGCCGCACGCCGACGACTCCCTCT
TCAAGCAAGCCGGCGCGGCGCCGCCGCCGACCACCTCCTCCTCCTCCTCCCACGGCGGCG
GAGGAGGCTTCCGCTTCAGCCCGAGGAGCGCCGAGGAGATCTTCTCGGAGATGTTCGGGG
GCGCATTCGGCGGCGCGGGGCCACGCGCCCCCGGCGCCGGGTTCCCGGGGTTCGGTGGGT
CCCCCCGGGCAGGGGAGACGTCGGCGACGAAAGCTCCGGCGATCGAGCGGCAGCTGGCTT
GCAGCCTTGAGGACCTCTACAGGGGCGCCACCAAGAAGATGA

Protein

134 aa

>Os05t0127400-01 Similar to DnaJ subfamily B member 13.
MGLDYYKVLGVGRGATDEELKRSYRRLATRTARRTPTTPSSSKPARRRRRPPPPPPPTAA
EEASASARGAPRRSSRRCSGAHSAARGHAPPAPGSRGSVGPPGQGRRRRRKLRRSSGSWL
AALRTSTGAPPRR*

5'UTR

chr05:1553459..1553622 (+ strand) : 164 bp

CDS

chr05:1553623..1553704 (+ strand) : 82 bp

chr05:1553721..1553766 (+ strand) : 46 bp

chr05:1553934..1554207 (+ strand) : 274 bp

3'UTR

chr05:1554208..1554238 (+ strand) : 31 bp

chr05:1556612..1557206 (+ strand) : 595 bp

FASTA

>Os05t0127400-01 class=Sequence position=chr05:1553459..1557206 (+ strand)
ACTACAAATT TATCTTTTCT CGAACGAAAA AAAAAAGCGA TAAAAACCAT CTCATCGAGG AAGAAAGCAA CCCACGATAA
CCCTCTTCTT CTTCTACCCA TCTCGCCGTC GCCGCCGCCG CCGCCGCCGC CGCCGTCGAA TCGATCGAAG CCCAGCAGCG
AGCGATGGGG CTGGACTACT ACAAGGTGCT CGGCGTGGGC CGCGGCGCCA CCGACGAGGA GCTCAAGAGA TCCTACCGCC
GCCTCGCCAT GAAGCACCAC CCCGACAAGA ACCGCTCGCC GCACGCCGAC GACTCCCTCT TCAAGCAAGT CTCCGAGGCC
TACGACGTCC GTACACCTCC CCTTCCTCCA TCGCCGCCGC CGCCGCACTC CACCTTTCTC ACTCACCCAC CTCCTCCTCC
TCCGCCGCCG TGCAGGTGCT CAGCGACCCG CAGAAGCGCG CCATCTACGA CCAGTTCGGC GAGGAAGGCC TCAAGGCCGG
CGCGGCGCCG CCGCCGACCA CCTCCTCCTC CTCCTCCCAC GGCGGCGGAG GAGGCTTCCG CTTCAGCCCG AGGAGCGCCG
AGGAGATCTT CTCGGAGATG TTCGGGGGCG CATTCGGCGG CGCGGGGCCA CGCGCCCCCG GCGCCGGGTT CCCGGGGTTC
GGTGGGTCCC CCCGGGCAGG GGAGACGTCG GCGACGAAAG CTCCGGCGAT CGAGCGGCAG CTGGCTTGCA GCCTTGAGGA
CCTCTACAGG GGCGCCACCA AGAAGATGAA GATCTCTAGG GATGTCCTCG ACGCCACTGG GTGAGACAGA TTTTTCTCCC
TTTTTTTTCT ATTCAAATCG ATTCAAATCA AACAGATTAT TGCTTAGAGT TCCTTGTAAA AATTGGCATT GCTGTTAATT
TGTTGTGTAT TTGTGATCTT GGTGAGCGAG TCTGCGAGGT TAGGCAGTAG CAGTAGCACC CTTGGTAACC AGCTCTTCTT
GCCTCATAGC ATGCACCTAC TAGTTCTAGA CTGCCATTGT AGATAATCTA ATTTTAGCCT GCCATTGATT CTTAGATAAT
CATGTTGCTC TAGATTCCAG CCTGACATTG TACATAATCT AATTTTAGCC TGCCATTGTA GATAATCCTG TCGCTCTAGA
TTTTATTCTG TCATGCTCCA GACGAGTAAC CTCATAGCGA CCTTTATGTT CTAGACGTTA TTCTGTCATG CAGTGAACCA
GCGGCCTCAT TGCAATTGCT GATTAGTTAA TGTATAGCAC AATGTAATGG TAGGGAAGAC GGAGTAAAGG GGAGGAAGGT
TGAGAGGAGA GGAAGATTGA GGGTAGTACA CGAGAGGAGA CATGAGAGAA GGTGAGGACA TTGCAATAGT TGCTTAGCTT
GCCTGATGTC CTCATGGGTT ATGCCACTTC ACATTTTCCT GTATGTTTGC TCCATTGAGA TGGCATAAAA ATGTGCAAGC
ATTAGTGTGC TTCAATCCAT ACTTCATTAC TTCTGTTGAG TATAGCCTCT TGGTGCTTAA TCTAATTTTG AACGATAACT
GATATGACTG AACCCTAGCT CTTTGGTGTG GCTCCATGTA GCCTGATGTA AACTTCGTAT TTAGCGTTAA CCTTGAGCTC
CATGCATCAT TTATGTGTAG TTGGAAATAG ATTATTTCAG TAACGGAGGA ATGCTTTTAT GGTCTGTATT TATTGTAAAC
TGCATAAACT GTTCCACGTG TTGAGAAATC CGATCTACAT CCAGCTCAGC ATGCTGCTAG TGTCCTCTTG TGTTATGGTT
TGTTTGAGAT AATAATAAAT TCTACCTTTA CAACCTTTCC AGCTTCATAA AGAATCCTTC TCAATAAACA CTTTCTGACA
TTGCAGCTAC GGAGCTACTA CTGTATAATG TATAAACATT AAAATAAAGT AGCATTTTAA TATTTTTGTG CACCCTGTTT
GCCTTTTCTG GTACTGTTTG TAACCAATAT GTCAATATTC GTCAGCTAAT GTACTTGCTG ACAAAAAAAA GTATTATTTC
CACTTTGTCA TCTAATGATA GCTGGTGTGA CAGTTGACAA TTGCCTTCTC GCAGATGCTG TTATGTGATG GAAAATTATT
ACTACGTTCA TAGCTTATAT TTTGCTGCAA TTAGGGGTCC TATTCAAAAC GGATCTTGGA GGGTTTAACT TCTAGAATGT
TGGGTTCCTG AGCATAATTA GCTTGTGTAC TAAGTCCACA GATTACAAAT AGGATGGATA TCAGAGTGCT CAGAGGCATG
CATAGATTTT GGTGATTGGG CTTTATTGTT GTGGGATGAT TTAATGTCCA CCATCAGAGA TAGACAATTG TCATTAATTT
CAGCATTCAG AATAGATGTA TTGTGGTGCT GTGTTTACTT GTTTACTTAC AGTGGTTGGG GCCCTTAGTT CTTAGGTATT
TTTTGTATAG CCTGTAGTAA AGTCAGGCAT ACTTATGACT ATGAGAGCAC CTGAACAAAA TGTATTACTC CTTTTAAATT
AAAGCTTACT GCACTTAGTT GACATAAAAA TTTCATCTTC AAGAACACTT AGGGCATTGT CTGTCCTCTA AGTATGCAAA
GATGGCCCAT TGGAACCTGT AATGGTATGA GATGACTTAC CTAATATGAA AGAACCTACT CCGTATTTAT TTAATTGAGT
TTGGAGCAGC ACTACAGGAT ATTTACTATT TGTTATGTCA GTTTTATGTC AATTTTTGTT ATTGTCATTC GACACGTAGC
AATCATTTTT AATCAAGTCC ATTGTCTTCT GAAAAAAGTA GCATAAAAAA TAATGGCAGA AATAATGGTG CTTTGGAAAA
CTAAAGCTTA GACAAATGAT TCATACAGTT TGTTTGTTTG TTTGGTGATT TGTAAATAAA GATAATAATA TAACCTCATA
TATCGGGCAT CTTGATGATT ATTAGTGTTT GGGCTATAGT GATGTCATGG ATAAATATGC GTAATTGTTT ATATGAAAGT
TATTATGGTT TACTGTATGC TGCATGGATA AGGCTTCATA ATTGATTATG CCAAGGTGTT ACGTATGACA TTCAATGATT
TTCTGAAACT TCAAATTCTT CTTTGCCGTA AAAGGAGCTT TGACTTTTCG GGGAAAAGGT AGGCCTATTA TTTCCGTGCC
CTTTTTACAA AATGTTTCTA TGTTTTTGTG CAGGAAACCG ACAAATCTGG AGGAGATCCT GACAATCGAT ATCAAGCCTG
GATGGAAGAA GGGTACAAAG GTAACCTTTC CCAAGAAAGG CAATGAGAAG CCTAACATCA TACCATCAGA CCTAGTGTTT
ATAATAGAAG AGCGGTCGCA CGCTAGATTC AAGCGAGACA AGGATGATCT TATTTACACG CATAGGATCT CGCTCGTGGA
GGCTTTGACC GGTTGCACAG TCCAACTGAC AACTCTGGAT GGGCGGAATT TAACCGTTCC AGTGAAGTCC GTCATCAATC
CTACTTCTGA AGAGGTTGTG AAGGGCGAAG GGATGCCAAT CACAAAGGAA CCGTCTAAGA AAGGGGATCT GAAGATCAGG
TTTCAGATCA AGTTCCCCAC CAATCTAACG TCTGACCAAA AGTCAGGGAT CCAGCAACTT TTGCCTAAGC CTTAACTGGT
AGTACAATAT TGTGAACCTG TATTTAGTCG TTTGTTTAGC AGTTGGGAAT ACATTGAGAG GGTTTGATCA CAGTTGCTGA
ATGTACAATC ACTGCTTCGG TGCAAGTATT GAAGAACATG TTTGCATTGG TATTTCCAAC ATTACTCC

Locus: Os05g0127400

Loading...

Locus: Os05g0127400

Loading...