Os05t0133900-02

Locus

Os05g0133900

Description

Similar to DNA methyl transferase 106.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

DRM3

CGSNL Gene Name

DOMAINS REARRANGED METHYLTRANSFERASE 3

Oryzabase Gene Symbol Synonym(s)

OsDRM3, DRM2-2

Oryzabase Gene Name Synonym(s)

domains rearranged methyltransferase 3, domains rearranged methylase 3

Transcript Evidence

AK063482 (DDBJ, Best hit)

Protein Evidence

NP_001105094.1 (RefSeq)

Literature

Note

Manual Curation

Full-length cDNA

001-116-B11 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0133900-02)

RiceXPro (AK063482)

Others

Oryzabase (10399)

KEGG (Os05t0133900-02)

Transcript

2694 bp

>Os05t0133900-02 Similar to DNA methyl transferase 106.
GCGCATCTTCCCCCTTTTGGAATCGCCCGGTCCCCATCTCCACTTCGAACCAAACCCGGA
GGCGCGCCGCGCGCCTCCCCGCCGCCGCCGTCGAGCGGGAGGGGATCGGAGCGCGCGGCC
GCCGCCGTCGCCGAGTCCGTCCGACCTCCGTCCCCCGCGCCAACGCAGCAGCAGAGCAGC
AGTGTGGGAAGGAAGAAGGGAAGCCGCTGCCGCGAGCGGCGAGCGGGAGTGGGGGTTTCT
CCATTGTTACCATTTCAGGCCAGCCGCCGTCGACGCCGAGGCGGGGTGGGCCCCACCTGT
CACTGGCCATGTTCGCCTCTATATATATACACCGCGCCGCCCCCCTTCCGCCGCCAACCT
GAGCCGAGCGGGGAGACGCGTCTTCCTCCTCCTCCTCCTCCATTGCTGCTCCCCCTCCCC
CTTCCTCCTACAGGGGCATGCGATTTTGGAAGCGGAGTTGATACTTGATCGAGATGGTTA
AAGTAGAAGATGATGTGGAGGGCAGTGGCATCAACGCTTCTGTTGGTGATCTCAGGGATG
CTGCTGTCAATCCACAGCCTGCCCTGCTGCGTGCTACTGTTAAGGAGGAGGAAGGACAGC
CAAGCTCTTCCTCCAGTCATGTAAGATCACAATTTATTGGCATGGGGTTTTCACCAATGT
TGGTTGACAGGGTGCTTCAGAAACACGGTGACAGAGATTCAGATACTATACTGGAGGCTC
TTTTGTCACAGTCTGCTCTTCAAAAATCTGGGTCTGAATCAGGTTCATTGGGAGATCTCT
TTGATTCTGATAATGAAGAAAATAGTTCTCATTTTGCGCCTAGGAAAGAAGTTATCCAAG
ACATTAAGGTTGAAGCTGATTCATCCTCAGAAAAGAGATCATATCTACTGAGTACAATGA
ACTTCTCGCAGCGAGAAGTTGATTTGGCACTCAACCAGCTAGGTGAGGAAGCATCATTGG
AACAGCTTGTAGATTTCATTGTTACTGGTCAAGTGTCAGGTTGCTCTGGAGGAAACGAAA
ATGGAGATGCTTCAAATGAGGTAAAGGATGAATCACTGTTTGGAGTAATGGATAAAACAC
TACATTTACTCCAGATGGGTTTTACGGAGGAAGAAGTGTCATCTGTCATTGACAAAGCTG
GTCCAGAAGCAACAGTTTTGGAGCTGGCTGACACCATTTTTGCACGTAGAATTGCCAGTA
GCATTGAGCAGAAAGAGGTGAAAGTTGAGCCTGACTTTCTAGATGAGACAGAAACCAGCT
ATTCAGCATACCATCCCTCAAATTCTGGTCTAAGGTACTATGATGACGACCATGACAACA
TAAGGATTAAAAGGGCTAAGCATATGTTTATAGATGACAGTGCGGGTTCCAGTAGTCGTG
CTGGAAATCAACCTAACTTAGATCCATGGCTTAAGGATCACCGTGCCACAACTAGTGATG
GGTCTGTCAAGGAAGAATTTGATGCAATGACACCAGGCATCCGTAGAAATGTTCGCAGTG
ATGTCGCCAATCCCCCATATTTCTTATATGGAAATGTTGTAGAAATTCCCAAAGCTACAT
GGCGTCAGCTGTCAGAGTTCTTATATAATGTGGAGCCAGAGTTTGTAAATAGCCAGTTTT
TCTCGGCTCTCTCACGAAAGGAGGGTTACATTCATAACCTTCCAACAGAGGGAAGGCGTA
ACCTGGTTCCTAGGTCACCAATGACTATCGAAGAAGCATTCCCATTCACAAGGCAGTGCT
GGCCATCGTGGGACACAAGAAAACAACTTAACAGTGTTGCTACAGAAGTTGCAGGAATAG
AGCAGCTGTGTGAGAGACTGGGAAAGATGGTAAGAGACTCAGGAGGTTATCTTTCACAAG
AAAAGAAAACGCACATCATGCACCAGTGCAAGCTGGCTAACCTCATCTGGGTTGGCCCAG
ATAGGTTAAGTCCTTTGGATCCACAACAAGTGGAACGGATACTTGGCTACCCACGGAAAC
ACACAAACCTGTTTGGCCTGAATCCACAAGATAGAATAGAAGCCATGAGGTACAGTTTCC
AGACTGACACACTCGGCTATCTTTTGTCAGTCCTGAAGGACCTGTATCCAGATGGGCTAA
GGGTGCTATCAATCTACAGTGGAATTGGAGGTGCAGCAATTGCCCTCCATCGCCTAGGGA
TACCACTACAGTGTGTAGTATCTGTTGACCAATCTGATACGAACAGGAAAATTTTGAGAA
GGTGGTGGAGTAATACTGAACAAAAGGGGCAACTGAGGCAGATAAATACCATTTGGAAGC
TGAAGATTAATGTACTTGAGGACCTGGTGAAAGAATTTGGTGGTTTTGACATAATTATTG
GTGGAAACTTCAGTTCCTGTAAAGGTGGTACAACAGTAAACTCATCCATGGGCATGGATT
CCAACCAGTTTTTTGAGTATGTTCGTGTTGTTCAAAGAGTGAAGCATATAATGGGTCGGC
TCCAGGTGAGGGCGCATGAATCTGCTCGACATCGACATCGCTCTCCATCAAATTGACTTG
TCTGGCCTTGTAGGATGGTGTAGCATTAGCATAGCATCATGTGGATCTGTAGGTGATGTG
TCATGGAGCAGTTGCTCTCAGACAACTTTAAATGTTATGTTGATCTCCGCAGAAACATTG
CGATGGCTGTTAGCATTCGTTACATTGCATTAATTACCCTTTCATGTTCCTGGT

CDS

2043 bp

>Os05t0133900-02 Similar to DNA methyl transferase 106.
ATGGTTAAAGTAGAAGATGATGTGGAGGGCAGTGGCATCAACGCTTCTGTTGGTGATCTC
AGGGATGCTGCTGTCAATCCACAGCCTGCCCTGCTGCGTGCTACTGTTAAGGAGGAGGAA
GGACAGCCAAGCTCTTCCTCCAGTCATGTAAGATCACAATTTATTGGCATGGGGTTTTCA
CCAATGTTGGTTGACAGGGTGCTTCAGAAACACGGTGACAGAGATTCAGATACTATACTG
GAGGCTCTTTTGTCACAGTCTGCTCTTCAAAAATCTGGGTCTGAATCAGGTTCATTGGGA
GATCTCTTTGATTCTGATAATGAAGAAAATAGTTCTCATTTTGCGCCTAGGAAAGAAGTT
ATCCAAGACATTAAGGTTGAAGCTGATTCATCCTCAGAAAAGAGATCATATCTACTGAGT
ACAATGAACTTCTCGCAGCGAGAAGTTGATTTGGCACTCAACCAGCTAGGTGAGGAAGCA
TCATTGGAACAGCTTGTAGATTTCATTGTTACTGGTCAAGTGTCAGGTTGCTCTGGAGGA
AACGAAAATGGAGATGCTTCAAATGAGGTAAAGGATGAATCACTGTTTGGAGTAATGGAT
AAAACACTACATTTACTCCAGATGGGTTTTACGGAGGAAGAAGTGTCATCTGTCATTGAC
AAAGCTGGTCCAGAAGCAACAGTTTTGGAGCTGGCTGACACCATTTTTGCACGTAGAATT
GCCAGTAGCATTGAGCAGAAAGAGGTGAAAGTTGAGCCTGACTTTCTAGATGAGACAGAA
ACCAGCTATTCAGCATACCATCCCTCAAATTCTGGTCTAAGGTACTATGATGACGACCAT
GACAACATAAGGATTAAAAGGGCTAAGCATATGTTTATAGATGACAGTGCGGGTTCCAGT
AGTCGTGCTGGAAATCAACCTAACTTAGATCCATGGCTTAAGGATCACCGTGCCACAACT
AGTGATGGGTCTGTCAAGGAAGAATTTGATGCAATGACACCAGGCATCCGTAGAAATGTT
CGCAGTGATGTCGCCAATCCCCCATATTTCTTATATGGAAATGTTGTAGAAATTCCCAAA
GCTACATGGCGTCAGCTGTCAGAGTTCTTATATAATGTGGAGCCAGAGTTTGTAAATAGC
CAGTTTTTCTCGGCTCTCTCACGAAAGGAGGGTTACATTCATAACCTTCCAACAGAGGGA
AGGCGTAACCTGGTTCCTAGGTCACCAATGACTATCGAAGAAGCATTCCCATTCACAAGG
CAGTGCTGGCCATCGTGGGACACAAGAAAACAACTTAACAGTGTTGCTACAGAAGTTGCA
GGAATAGAGCAGCTGTGTGAGAGACTGGGAAAGATGGTAAGAGACTCAGGAGGTTATCTT
TCACAAGAAAAGAAAACGCACATCATGCACCAGTGCAAGCTGGCTAACCTCATCTGGGTT
GGCCCAGATAGGTTAAGTCCTTTGGATCCACAACAAGTGGAACGGATACTTGGCTACCCA
CGGAAACACACAAACCTGTTTGGCCTGAATCCACAAGATAGAATAGAAGCCATGAGGTAC
AGTTTCCAGACTGACACACTCGGCTATCTTTTGTCAGTCCTGAAGGACCTGTATCCAGAT
GGGCTAAGGGTGCTATCAATCTACAGTGGAATTGGAGGTGCAGCAATTGCCCTCCATCGC
CTAGGGATACCACTACAGTGTGTAGTATCTGTTGACCAATCTGATACGAACAGGAAAATT
TTGAGAAGGTGGTGGAGTAATACTGAACAAAAGGGGCAACTGAGGCAGATAAATACCATT
TGGAAGCTGAAGATTAATGTACTTGAGGACCTGGTGAAAGAATTTGGTGGTTTTGACATA
ATTATTGGTGGAAACTTCAGTTCCTGTAAAGGTGGTACAACAGTAAACTCATCCATGGGC
ATGGATTCCAACCAGTTTTTTGAGTATGTTCGTGTTGTTCAAAGAGTGAAGCATATAATG
GGTCGGCTCCAGGTGAGGGCGCATGAATCTGCTCGACATCGACATCGCTCTCCATCAAAT
TGA

Protein

681 aa

>Os05t0133900-02 Similar to DNA methyl transferase 106.
MVKVEDDVEGSGINASVGDLRDAAVNPQPALLRATVKEEEGQPSSSSSHVRSQFIGMGFS
PMLVDRVLQKHGDRDSDTILEALLSQSALQKSGSESGSLGDLFDSDNEENSSHFAPRKEV
IQDIKVEADSSSEKRSYLLSTMNFSQREVDLALNQLGEEASLEQLVDFIVTGQVSGCSGG
NENGDASNEVKDESLFGVMDKTLHLLQMGFTEEEVSSVIDKAGPEATVLELADTIFARRI
ASSIEQKEVKVEPDFLDETETSYSAYHPSNSGLRYYDDDHDNIRIKRAKHMFIDDSAGSS
SRAGNQPNLDPWLKDHRATTSDGSVKEEFDAMTPGIRRNVRSDVANPPYFLYGNVVEIPK
ATWRQLSEFLYNVEPEFVNSQFFSALSRKEGYIHNLPTEGRRNLVPRSPMTIEEAFPFTR
QCWPSWDTRKQLNSVATEVAGIEQLCERLGKMVRDSGGYLSQEKKTHIMHQCKLANLIWV
GPDRLSPLDPQQVERILGYPRKHTNLFGLNPQDRIEAMRYSFQTDTLGYLLSVLKDLYPD
GLRVLSIYSGIGGAAIALHRLGIPLQCVVSVDQSDTNRKILRRWWSNTEQKGQLRQINTI
WKLKINVLEDLVKEFGGFDIIIGGNFSSCKGGTTVNSSMGMDSNQFFEYVRVVQRVKHIM
GRLQVRAHESARHRHRSPSN*

5'UTR

chr05:1965596..1966028 (+ strand) : 433 bp

chr05:1967315..1967354 (+ strand) : 40 bp

CDS

chr05:1967355..1967357 (+ strand) : 3 bp

chr05:1967468..1967581 (+ strand) : 114 bp

chr05:1968557..1968653 (+ strand) : 97 bp

chr05:1968789..1968835 (+ strand) : 47 bp

chr05:1969225..1969338 (+ strand) : 114 bp

chr05:1969423..1969516 (+ strand) : 94 bp

chr05:1969759..1969856 (+ strand) : 98 bp

chr05:1970755..1970854 (+ strand) : 100 bp

chr05:1971844..1971920 (+ strand) : 77 bp

chr05:1972223..1973521 (+ strand) : 1299 bp

3'UTR

chr05:1973522..1973699 (+ strand) : 178 bp

FASTA

>Os05t0133900-02 class=Sequence position=chr05:1965596..1973699 (+ strand)
GCGCATCTTC CCCCTTTTGG AATCGCCCGG TCCCCATCTC CACTTCGAAC CAAACCCGGA GGCGCGCCGC GCGCCTCCCC
GCCGCCGCCG TCGAGCGGGA GGGGATCGGA GCGCGCGGCC GCCGCCGTCG CCGAGTCCGT CCGACCTCCG TCCCCCGCGC
CAACGCAGCA GCAGAGCAGC AGTGTGGGAA GGAAGAAGGG AAGCCGCTGC CGCGAGCGGC GAGCGGGAGT GGGGGTTTCT
CCATTGTTAC CATTTCAGGC CAGCCGCCGT CGACGCCGAG GCGGGGTGGG CCCCACCTGT CACTGGCCAT GTTCGCCTCT
ATATATATAC ACCGCGCCGC CCCCCTTCCG CCGCCAACCT GAGCCGAGCG GGGAGACGCG TCTTCCTCCT CCTCCTCCTC
CATTGCTGCT CCCCCTCCCC CTTCCTCCTA CAGGTTCGTT CGTCTTCCCC CTCTCCTCCT CGTTGTCCAG CCCGCGATTT
CTCTACTCGG ATTGCTCGAT CCCCTACCGC CCATGGGTTT TCTCGCGATT TTTTTTTTTA ATTTTTTGGG GATGGAAATG
GTTAGCTCAT GCGAGGAACA ACCGATTAGG GTTTAGTTTA ACGCCTCGCT ATCCTCTCGA AATGCGAGGA ACAACCATTT
CATCTTGCCC TCTCTTCCTT GCTTGTTCCG CTCGCGATTT CTCTACTCGG ATTGCTCGAT CCCCTACCGC CCATGGGTTT
TCTCGCGATT TTTGTTTTTT GTTTTTTTTA TAAATTTTTT GGGATGGAAA TGGTTAGCTC ATGCGAGGAA CAACCGATTA
GGGTTTAGTT TAACGAATCC TTATCCTCTC GAAATCGATT TAGATTATTA GGATTGTGGC CGTTTTGTTT GCGCTCCTCT
CCGGTTGTAG TGTTGTCTCC ATTTCTATGG GTTTAGTCGC CATGTGAGAG ATGATTCAAA GTTTCAAGCT ATGTGGTATG
GGAATCCAAA CTTCTGTTGG GATCTTCTTC CAAACTTTGT GGTATGGCGA TTTTTGCTTT TTTTTTTTGG GTGCTGGAAA
TGGTTAGCTC ATGCGAGGAA CAACCGATTA GGGTTTAGTT TAAGGCCTCA TTATCCTCTT GAAATCGATT TAGATGATTA
GGATTGTAGC CGTTTTGTTT GCGCTCCTCT CCAGTTGTAG TGGTGTCTCC ATTTCTATGG GTTTAGTTGC CATGTGAGAT
GATTCAAAGT TTCAAACTAT GTGGTATGGG AATCCAAACT TCTGTTGGGA TCTTCTTCCA AACTATGTGG TGTGGCCATT
TTTGCCTTTT TTTTTTGGGT GCTGGAAATG GTTAGCTCAT GCGAGGAACA ACCGATTAGG GTTTAGTTTA ACGCCTCCTT
ATCCTCTCTA AATCGTTTTG GATGATTAGG ATTGCGGGCG TTTAGTTTGC GCCGCTCTCC GGTTGTATTG TTGTCTCCAT
TTCTATGGGT TTAGTCGCCC TGTGAGAGGT GGTGGATTCA GACTATGTGT GGTATGGGAA TCCAAACTTT TTGTTGGGAT
CTTCTTCCAT TATATGTTGA GATAGATAGG ATTTTTACCA TTACGCAATA TGGGGCACCC TTCTTGGGTT GTGTTTTTTT
TGTCTCCATT TCTATGGGTT TAATCGCACC CTTGAGTTGA TCCAAACCTG TGGGGGATGG AAATCCAAGT TTATGCTGCT
ATAAGATACT CATCGCGCTA TCGTCTTTGT TTCTTGCAGG GGCATGCGAT TTTGGAAGCG GAGTTGATAC TTGATCGAGA
TGGTAATGGA GGGCATCTGT GCTCCCTCTA TTATTTAGCT CTCTCTATTA TTTTGTGTTT TTTGATTTTG TTCCGTCTCT
CACTATATGC TGGCTTTTAT TGGTACACAA AGGTTAAAGT AGAAGATGAT GTGGAGGGCA GTGGCATCAA CGCTTCTGTT
GGTGATCTCA GGGATGCTGC TGTCAATCCA CAGCCTGCCC TGCTGCGTGC TACTGTTAAG GAGGAGGTGG TGATTTTGCT
TCCAAACCTT CTGGTGTATT AATCTTTGCT TGGAGTAGTG TTTTGCATGG CATGCTAAAC TATTTGGATG AATCGATTAT
GTATATTACA TTATTAAAAC AAGGGTGAAA AGGAGTCACC GTATTTTGCT TTCCATGCCT AGAAGTTATC ATGTTATTCA
CAGAAAAAAA AAGTATCTAT GCTGTTGACT GTGGTGTGGG GTCCATATTA TTATAGTTGA GGTTAAAACA AAGTCTCCAT
GTCAAATACG ATTAATGAGT AATGGCAATT ACGCGGGAAA TTTGGGCAGT TATTATTTTA GGGCCAGGCG GGTTGAGCGC
TTCTCATTTA CCACTTGTAG AGTGTGGTTT TATTATGGCG GCAATGTGCT GTCTGTTATG TCGTGCTTGA AGTGGAAAGC
AAAGCTATAA TTTTGTGCAC AGGCTTCCAG TTGCTAATCG CTATATGCAC CTGAGTTGTT TGCATTGTAC CAAGAAGTTA
TTTCTTGAAA CAACAATAGA ATCATCTGTG TCTTTGGGCA CTAGACCCAA ATTCAATATA ATTCTAGATT GCACCCCCCC
TCTCCCCTAC CCTGTGAGCT ACTTTCTAAC TGAGCCTCTT TTTTTGGTAT TGTGCTTTGA TTTGAGGCGA ACACATCTGC
CAAACACCAA ATCAGGATGA CTTACAAATA CAACCAATTT TAATAGACTT GACGTTTGTT TTGGATGTAA TCTATATTGA
CAGTAGTACA TCTAAGATGC AGTTGATTGA TGGTGTTAAG TATTTGAAAG TAACTGGGTG TTGACCTAAC CATAGGTATA
TTGCTAACAA CCAGAGGTCC ACAACTTTAA ATAGTTAATA CTCCTTTTGA CATGTTAACT TTTCCTTTGG TTCCTTTTAA
TATTTTATTT TATTTATTTT TGCGGGGGTT CCTTTTAATA AAGTTGTGAT ACCAACAAAA TGTTCTTCAC ATATATTGTA
GGAAGGACAG CCAAGCTCTT CCTCCAGTCA TGTAAGATCA CAATTTATTG GCATGGGGTT TTCACCAATG TTGGTTGACA
GGGTGCTTCA GAAACACGGT AATATCCTAT GACATGCCTT TTCAAATGCA TGTAGTGATA TAAAACTTTT GCACCAGTTA
AAACACAGTT AAATCCAAAC ATTTTATACA CCTTAGAGTT TACGAACTGA TTACATTTAT CTCTCTCATG CAGGTGACAG
AGATTCAGAT ACTATACTGG AGGCTCTTTT GTCACAGTCT GTAAGTGATT CCCCAGCTGC ATGTCAACAT TTGTCCCGTT
AATCTCAATA TTCTGGTTTT CTTTCTTTAG GAAATGGTTT CCTCTCCTAA CCTTGATGTT ACCTATTTAT ATTTTTCTGT
GTTATTGTTT TATGACTCGA ATAGTTTACC ATTAAAGCTC CCATTATGAT CCTCCATTTA CTTTAATGTT GCTAGTGTAA
TTTTATCTTA AGTACACCTT CATGTAGTTG GATTGATGTT TACTTAAATG ACTGATATTC AATTTGGTAT CAGGAATTTT
AGTTTCCATC TAATTTTGTT GGCATTGCTA CAGTAGTCAA TAATTGTGTT GTAATGAGTT GTGGAATTCA CAATACTTGA
ATTTATTTTT CAATTTTCAT ATGTTATAGG CTCTTCAAAA ATCTGGGTCT GAATCAGGTT CATTGGGAGA TCTCTTTGAT
TCTGATAATG AAGAAAATAG TTCTCATTTT GCGCCTAGGA AAGAAGTTAT CCAAGACATT AAGGTGATGT TCTGGTTCAA
AATGTTAATC ATGGTACTAT TCATTTTGAA CTCCTTAGAC CAATCTGCAC AACATTTCTA TTTTTAGGTT GAAGCTGATT
CATCCTCAGA AAAGAGATCA TATCTACTGA GTACAATGAA CTTCTCGCAG CGAGAAGTTG ATTTGGCACT CAACCAGCTA
GGTAGGTGAT GCTGCATTGA CTTGTGCAAT TAGCAATTTA TCTTTTTAAT TGTCTAGATC TTGTACTGTT GCCTTTTCTT
TTTTTTTTTG GTGTTGATAT CAGTTCAACC AATTGTACTA CACAATTTTT AAGACACTGT TGAACAAGAA TGTGTTCAGG
ACACATTTTA GATCTGTTTG ATAGTCATTC TATTCTTTGT CATATCCAGC ATACTGTAAA CTTCCAGACC TGCTTGGTTT
CAGGTGAGGA AGCATCATTG GAACAGCTTG TAGATTTCAT TGTTACTGGT CAAGTGTCAG GTTGCTCTGG AGGAAACGAA
AATGGAGATG CTTCAAATGA GGTTTTCGCC AGTTCTTTTG TTTTCTGTTT CTTACATCTG ACTAACATTG TCTGAGTACA
TGAAGTAAAT ATTGAGCTCG CTGCTCCAAG AATCTTTACT CCTTTATGAA ATGTAAAACA CACTTTTCTT TTTGACATTA
AATGTAAAAC ACACTTAATA ACTTTTAATA ATATGTAGCT TTGTGAAAGA CTCATTATTC AGTGAACTGG TGTTACTGCT
ATGAGACTAG TAGAACATTG TACATTATCC AACTCTGGAA AAGTTGTTCC AGAGTCTATT CCGTACTTAT CCAATCACAA
AAATTGGTGC TCCAAATCTC TCTAGTTTAT TATGTGTTGC GTCCAGTTAC AGAATATCCT TGTTCATACC AGATTGTCAC
TTGGACATTC TGCTTCATAC TATCCCAGCT ATGAAATCGC AGCCAAATTT TCTACTTATA TTTCGCATCA ACGACAATTG
AGAATTCTCC TTTTAATTCT GTGTTTTTAC TTGGTAGTCG ATAATGTAAC AACATGTAAA CCACAGGATC ACATTATTTT
GTGCTTGTTG GTACTCACAT TGTCTTGTCA GCCATGCTTT GTAGGTCTCC TATTGTGTAC CCTAGAAACT TCTTACTACA
GTCTGCAGTA TAGATGTTTA ATTCCTTTTG ATACTACAAT GACATGAACT ATACTTAGCC TGGAGCATGC ATCATGTTTT
TCTTCAGTCA TGCTTATAGT TATATGTGTT CTTTCTTTGA CATTCTATTT TTGATAGATG GGATCTGTAT CATGGTTATC
AATCATGTTT ATGATATTTT TGTGTTCTTT CTTTAACACT AATTTTGATA AATGATATTT GTAATTGGCT ACAAATGAGC
AACAACAGAA CTGTATATTT AAAATCACAT TTGTTTCAGG TAAAGGATGA ATCACTGTTT GGAGTAATGG ATAAAACACT
ACATTTACTC CAGATGGGTT TTACGGAGGA AGAAGTGTCA TCTGTCATTG ACAAAGCTGG TAAGTGAAAA TAAAAATGCT
TTAAAAAATT ACTCAGATCT GTGAGCTTCA TGACCACAGT CCACAGCATA TGGTGAAGTA CTCTCTCCGG TCAAATTTAT
TTGACGCTGG GTGTACTAAG TTTAGTACTC CCAGCATCAA ATAAATGTGA CTAGAGGGAG TTTCACAAAG TGAAATCCTT
AAAATCTAAT ACCACAGCAT GCACCAGTAC ATTGGCACCT GATCTCTGAT AATACTGTAC CTGTCAACAA ACACTTGTCA
TTCTTGAACC TTTACCATTG CAAAGCTTTT CCAAGCAATC TTTTGGTTTT ATTCAATTGG ACTAGATCGA TAAATCTTTG
TCGCATCAAA TAGATGATTG GGGAGCATGC AAAAAGGAAA TTAACAAGGA AAAAGTTATG AAAAATATGC TTTGGAAAAG
CATGAGTAAC AAAATATATG AACGATTGAA ACGATCAGTT CTGACAAATA TTTGTAACAA AGGGTGTTTT TATTCATGTT
AACAGTATAC TTAATTTTAC TTATTTTACC GAATCCTAAC CTTGCTCATA GATTTTGTCA AGGACGAACC TTTCAGACTT
TCTATGTATG ATTCATGCCT GCTTTGTACA TAAGGTGGCT CCCCATGGAT ACATATATGC CATTTTAAGC TAAAAGGACT
GTAAATTCAA TCTCATGTCT CATCCAGAGC ATCTGATTGC ACGCACATGG CATCCGCAGG TGCCTCACTC ATGTACATGG
ATAAAACGTT GCATGCAAGT GGTAAAAGGG AATTCATATT TCACATTGTA GTTATAGTTT TAGCCCCCAA ATTTTTGGTA
TTAAAAATTT CAATCTTCCT TGTAATACAT TTGATTATTT TCTATATCAA TATTCCATTC TCTCATTAGT TACCAGTTTC
TATGTTGTAT GTACTAGAAT ATACTGTTTT AATGAGTTCC TACCTCTAGC AAACTTAATG CCATATTTCC TTGTTCCTAC
CTTTTCAGGT CCAGAAGCAA CAGTTTTGGA GCTGGCTGAC ACCATTTTTG CACGTAGAAT TGCCAGTAGC ATTGAGCAGA
AAGAGGTAAT TTCGTCAACA TTTTATTCTT ACAGCTATAA GCTTGTATTG TGAATTTACA GTCATCTGTT GCTTGGTAGC
ATTGTCCATG ACAACTGTGC AGAGCGCACA GCAGATTAGT AGGAACCTTT TTATATAAAC AATTTGCTTG AATTACAAAA
TATCCCTCTA ACCAAACACT TATACCGTTC TCAGCAAACC AATGTTTTTC TTTAAATGCT GCTCATATGG CTGTACAGCA
TATTGTTATA CACAAGTCAC AACTGTTATG ATTTCTAATT TGTCTGCATT TGCATTCTTG TGCACAGGTG AAAGTTGAGC
CTGACTTTCT AGATGAGACA GAAACCAGCT ATTCAGCATA CCATCCCTCA AATTCTGGTC TAAGGTACTA TGATGACGAC
CATGACAACA TAAGGATTAA AAGGGCTAAG CATATGTTTA TAGATGACAG TGCGGGTTCC AGTAGTCGTG CTGGAAATCA
ACCTAACTTA GATCCATGGC TTAAGGATCA CCGTGCCACA ACTAGTGATG GGTCTGTCAA GGAAGAATTT GATGCAATGA
CACCAGGCAT CCGTAGAAAT GTTCGCAGTG ATGTCGCCAA TCCCCCATAT TTCTTATATG GAAATGTTGT AGAAATTCCC
AAAGCTACAT GGCGTCAGCT GTCAGAGTTC TTATATAATG TGGAGCCAGA GTTTGTAAAT AGCCAGTTTT TCTCGGCTCT
CTCACGAAAG GAGGGTTACA TTCATAACCT TCCAACAGAG GGAAGGCGTA ACCTGGTTCC TAGGTCACCA ATGACTATCG
AAGAAGCATT CCCATTCACA AGGCAGTGCT GGCCATCGTG GGACACAAGA AAACAACTTA ACAGTGTTGC TACAGAAGTT
GCAGGAATAG AGCAGCTGTG TGAGAGACTG GGAAAGATGG TAAGAGACTC AGGAGGTTAT CTTTCACAAG AAAAGAAAAC
GCACATCATG CACCAGTGCA AGCTGGCTAA CCTCATCTGG GTTGGCCCAG ATAGGTTAAG TCCTTTGGAT CCACAACAAG
TGGAACGGAT ACTTGGCTAC CCACGGAAAC ACACAAACCT GTTTGGCCTG AATCCACAAG ATAGAATAGA AGCCATGAGG
TACAGTTTCC AGACTGACAC ACTCGGCTAT CTTTTGTCAG TCCTGAAGGA CCTGTATCCA GATGGGCTAA GGGTGCTATC
AATCTACAGT GGAATTGGAG GTGCAGCAAT TGCCCTCCAT CGCCTAGGGA TACCACTACA GTGTGTAGTA TCTGTTGACC
AATCTGATAC GAACAGGAAA ATTTTGAGAA GGTGGTGGAG TAATACTGAA CAAAAGGGGC AACTGAGGCA GATAAATACC
ATTTGGAAGC TGAAGATTAA TGTACTTGAG GACCTGGTGA AAGAATTTGG TGGTTTTGAC ATAATTATTG GTGGAAACTT
CAGTTCCTGT AAAGGTGGTA CAACAGTAAA CTCATCCATG GGCATGGATT CCAACCAGTT TTTTGAGTAT GTTCGTGTTG
TTCAAAGAGT GAAGCATATA ATGGGTCGGC TCCAGGTGAG GGCGCATGAA TCTGCTCGAC ATCGACATCG CTCTCCATCA
AATTGACTTG TCTGGCCTTG TAGGATGGTG TAGCATTAGC ATAGCATCAT GTGGATCTGT AGGTGATGTG TCATGGAGCA
GTTGCTCTCA GACAACTTTA AATGTTATGT TGATCTCCGC AGAAACATTG CGATGGCTGT TAGCATTCGT TACATTGCAT
TAATTACCCT TTCATGTTCC TGGT

Locus: Os05g0133900

Loading...

Locus: Os05g0133900

Loading...