Os05t0134000-01

Locus

Os05g0134000

Description

Similar to Glycogen synthase kinase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSK13/OsGSK6, OsSK13, OsGSK6, SK13, GSK6

Oryzabase Gene Name Synonym(s)

Protein kinase-alfalfa (MSK-3) homolog, GSK3/SHAGGY-Like Kinase 13, GSK3-like Kinase 6

Transcript Evidence

AK064884 (DDBJ, Best hit)

Protein Evidence

Q1AMT7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: protein tyrosine kinase activity (GO:0004713)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

Tyrosine-protein kinase, catalytic domain (IPR020635)

Full-length cDNA

J013000K07 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0134000-01)

RiceXPro (AK064884)

Others

Oryzabase (17749)

KEGG (Os05t0134000-01 (EC:2.7.11.26))

Transcript

2018 bp

>Os05t0134000-01 Similar to Glycogen synthase kinase.
TCTCCCTCCGAATCCTCCCCCGCATTCCGCGCCGGAGCTGAGGAGGGACAGCGAGCCAGC
GAGGGAGGTGGGGCAATCCAGCGAGCGCCAGATCGTGCCGCCAGCCCCGCTCCGTCCTCT
CTCCGGCGACCCTCCGCCCCGCCTGATCCCGTGGTGGATCAACTACAACTCATCTTTAGG
AAAGCCTCTTGAACATTAGCCTTGTGTGCCTTTCAACAGTATGGCCTCGGTAGGTGTGGT
GCGTTCTTCCTTGGGGTTTCAGAACGAAACAAGTACAAGTGGCGATGCCGACCGACTTCC
GAATGAGATGAGCAATATGAGTATAAGGGATGATAATAAGGACATTGACGACATAGTTGT
CAATGGCAATGGGACAGAACCTGGTCATGTTATTGTGACAAGCATTGATGGAAGAAATGG
ACAGGCTAAACAGACCATTAGCTACATGGCCGAGCGTGTCGTAGGTCATGGATCCTTTGG
AACTGTTTTCCAGGCCAAGTGCCTGGAAACCGGTGAGACTGTGGCTATAAAGAAGGTTCT
TCAAGACAAGAGATATAAGAACCGTGAGCTGCAAACAATGCGAGTTCTTGACCACCCAAA
TGTGGTGTCACTAAAGCATTGTTTTTTCTCAAAGACTGAGAAGGAGGAGCTTTACCTCAA
TTTGGTGCTTGAGTATGTGCCAGAGACTGCTCACCGTGTAATTAAACATTACAACAAGAT
GAACCAACGCATGCCATTGATATATGCAAAACTATACATGTATCAGATATGCAGAGCTTT
GGCGTACATTCACAACACCATTGGCGTGTGTCACAGGGATATCAAGCCACAAAATCTTCT
GGTGAACCCACATACTCATCAGCTGAAATTATGTGACTTCGGCAGCGCGAAAGTCTTGGT
AAAAGGAGAACCAAATATTTCTTACATCTGTTCAAGGTACTACAGAGCTCCAGAGCTCAT
ATTTGGTGCTACTGAATACACAACAGCGATTGATGTTTGGTCTGCCGGTTGTGTGCTTGC
TGAACTCCTCCTGGGGCAGCCTCTATTCCCTGGCGACAGTGGCGTTGATCAGCTTGTTGA
AATCATCAAGGTTCTGGGTACCCCTACACGAGAGGAGATTAAGTGCATGAACCCAAATTA
CACCGAGTTTAAATTTCCGCAAATCAAAGCTCACCCATGGCACAAGATCTTCCATAAAAG
AATGCCTGCTGAAGCAGTCGATCTCGTCTCCAGGCTTTTGCAGTATTCACCATACCTCCG
GTCCACTGCTGTGAGTGTTGTCGTTGCACTATTTGAGCCAACACCATTTTTTAGAGAAAG
TTTTAGTTCTTGGCATCACTATTGTGTTACATTTTTCTAATTACTTCATCATACAAACAT
GCACTGCCTTGCCAAGTACTAGTAGTTACAGATTGTGCATTTCTTTATTTGCCATTACAG
TCGGAAGCATTGATCCATCCCTTCTTCGATGAACTCCGTGATCCAAACACCCGCTTACCG
AACGGCCGTTTCCTTCCTCCTCTCTTCAACTTCAAGCCCCATGAACTGAAGGGTATGCCA
ATGGAATTCCTGGTGAAGCTTATCCCCGAACATGCTCGAAAGCAATGCGCGTTTGTAGGA
TGGTGATTTCTGAGGTCAGCATGAAAACTAGTTCAGAATTTCTTCACCGTCCTCCATTAG
AAAGCAGAGATGAACCCTGTGTGCAGCCATTTGGGAAAGCTGGTGCATATGGAAGTGGAA
CTACATTTTTTTGTCCGAGATTCTGACGCCGCGTATTCTTTTCCCCCCTCCCACTTTGCT
GCTGCCGGTGTAACCAAAAAATCATCCACGGTTCTGTAAAGTTGATGAAGAAGAGTGTAA
AATCAGGTTGAAAACTGAATTCGATCGGTTTGTCAAGATTGTAGCAACATGCAAGGAAGG
ATGTTGCACACTTTGTATGGCAATGTTCGTTCGGTCCAAATATTTGGACATGGATCGAGA
GGCTATTCATTTAATTGTACTTGCTGCTACATGTTCTT

CDS

1140 bp

>Os05t0134000-01 Similar to Glycogen synthase kinase.
ATGGCCTCGGTAGGTGTGGTGCGTTCTTCCTTGGGGTTTCAGAACGAAACAAGTACAAGT
GGCGATGCCGACCGACTTCCGAATGAGATGAGCAATATGAGTATAAGGGATGATAATAAG
GACATTGACGACATAGTTGTCAATGGCAATGGGACAGAACCTGGTCATGTTATTGTGACA
AGCATTGATGGAAGAAATGGACAGGCTAAACAGACCATTAGCTACATGGCCGAGCGTGTC
GTAGGTCATGGATCCTTTGGAACTGTTTTCCAGGCCAAGTGCCTGGAAACCGGTGAGACT
GTGGCTATAAAGAAGGTTCTTCAAGACAAGAGATATAAGAACCGTGAGCTGCAAACAATG
CGAGTTCTTGACCACCCAAATGTGGTGTCACTAAAGCATTGTTTTTTCTCAAAGACTGAG
AAGGAGGAGCTTTACCTCAATTTGGTGCTTGAGTATGTGCCAGAGACTGCTCACCGTGTA
ATTAAACATTACAACAAGATGAACCAACGCATGCCATTGATATATGCAAAACTATACATG
TATCAGATATGCAGAGCTTTGGCGTACATTCACAACACCATTGGCGTGTGTCACAGGGAT
ATCAAGCCACAAAATCTTCTGGTGAACCCACATACTCATCAGCTGAAATTATGTGACTTC
GGCAGCGCGAAAGTCTTGGTAAAAGGAGAACCAAATATTTCTTACATCTGTTCAAGGTAC
TACAGAGCTCCAGAGCTCATATTTGGTGCTACTGAATACACAACAGCGATTGATGTTTGG
TCTGCCGGTTGTGTGCTTGCTGAACTCCTCCTGGGGCAGCCTCTATTCCCTGGCGACAGT
GGCGTTGATCAGCTTGTTGAAATCATCAAGGTTCTGGGTACCCCTACACGAGAGGAGATT
AAGTGCATGAACCCAAATTACACCGAGTTTAAATTTCCGCAAATCAAAGCTCACCCATGG
CACAAGATCTTCCATAAAAGAATGCCTGCTGAAGCAGTCGATCTCGTCTCCAGGCTTTTG
CAGTATTCACCATACCTCCGGTCCACTGCTGTGAGTGTTGTCGTTGCACTATTTGAGCCA
ACACCATTTTTTAGAGAAAGTTTTAGTTCTTGGCATCACTATTGTGTTACATTTTTCTAA

Protein

380 aa

>Os05t0134000-01 Similar to Glycogen synthase kinase.
MASVGVVRSSLGFQNETSTSGDADRLPNEMSNMSIRDDNKDIDDIVVNGNGTEPGHVIVT
SIDGRNGQAKQTISYMAERVVGHGSFGTVFQAKCLETGETVAIKKVLQDKRYKNRELQTM
RVLDHPNVVSLKHCFFSKTEKEELYLNLVLEYVPETAHRVIKHYNKMNQRMPLIYAKLYM
YQICRALAYIHNTIGVCHRDIKPQNLLVNPHTHQLKLCDFGSAKVLVKGEPNISYICSRY
YRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGDSGVDQLVEIIKVLGTPTREEI
KCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPYLRSTAVSVVVALFEP
TPFFRESFSSWHHYCVTFF*

5'UTR

chr05:1977684..1977836 (- strand) : 153 bp

chr05:1976800..1976866 (- strand) : 67 bp

CDS

chr05:1976680..1976799 (- strand) : 120 bp

chr05:1976508..1976600 (- strand) : 93 bp

chr05:1976334..1976393 (- strand) : 60 bp

chr05:1975955..1976227 (- strand) : 273 bp

chr05:1975795..1975869 (- strand) : 75 bp

chr05:1975620..1975676 (- strand) : 57 bp

chr05:1975400..1975540 (- strand) : 141 bp

chr05:1975258..1975308 (- strand) : 51 bp

chr05:1975086..1975181 (- strand) : 96 bp

chr05:1974825..1974998 (- strand) : 174 bp

3'UTR

chr05:1974642..1974824 (- strand) : 183 bp

chr05:1974067..1974541 (- strand) : 475 bp

FASTA

>Os05t0134000-01 class=Sequence position=chr05:1974067..1977836 (- strand)
TCTCCCTCCG AATCCTCCCC CGCATTCCGC GCCGGAGCTG AGGAGGGACA GCGAGCCAGC GAGGGAGGTG GGGCAATCCA
GCGAGCGCCA GATCGTGCCG CCAGCCCCGC TCCGTCCTCT CTCCGGCGAC CCTCCGCCCC GCCTGATCCC GTGGTAAATC
CCTCTCGCCT CTGTTTCTTG GATCCCGTGG TTCTTCTCTC TGCTTGTTCT TGCCCGATTC GACGGTTGAC GCGGCCGTGG
TTGCTCTTGG ATCGTGGCTT GGTTGGATTT TTCTTTTTCA AGGGGTGGAA GGGAAAGCTG GTTCTTTTTT TTTCCTTCTT
TTTCTTTTTT TTTTTTGGTG TGTGTGTTCG TTTGTTCTTG TGATTTTCTT GGGGGTGGGG AAGATGGTGG CGGTTTCCGA
GGTCGGATCG GATACTTGTT CGTCCTGCTG ATTTTGCATT TTGATCGGTG ATTCTGGTGG CTTTCTTCTA TTTGGATGAT
GCGTGTGATT GGAGGGAGAT GAGTTGATGG GGGAAAGATG GTTTAGTTTG GTTGATGCAA AATTTGGTGG TCTCTGGATC
GGTGAAATGT TCCCTTCTCT TGGCTGTTAT GGATAGCAAG CATGGGTGGA TGAACTGGTT GATTCTTGAA AGCTACCGCC
TCGGGATAAT CTCCCAATGA TCGTGGTTGA AAATATCATG ATAAACGGGG GGTAATTGGT ACAGATTAGC ATTCTAATAT
CTTCAGATTC TGTGTTTCGA TTGAGCTAGA AAAGTAACAC TCCAGTTTTG ATAACAACTC GGCATCCATC ATGGATTCCC
AAAGTTTCAT TTCTTCTTTT TTTTTCTTTT CCTGTACCTT CAAGCCTACC TGCCAATTGC CAACACAAAC TGTCTGTGAA
TGTGCTTCTG GCACCTAATC TCATCACATC TTTCTTAAGT AAAAACACTG TTGTGACTTT GACTTACCAT TATTATGCTG
TTGTTTGCAG GTGGATCAAC TACAACTCAT CTTTAGGAAA GCCTCTTGAA CATTAGCCTT GTGTGCCTTT CAACAGTATG
GCCTCGGTAG GTGTGGTGCG TTCTTCCTTG GGGTTTCAGA ACGAAACAAG TACAAGTGGC GATGCCGACC GACTTCCGAA
TGAGATGAGC AATATGAGTA TAAGGGATGA TAATAAGGTA TTATGCCTAA GAGTGGTGGA TCATAGTTGC CTTTTGCTGT
ATTGTCAGTT GCTGATTTGA TTCACAAACG TCGCAGGACA TTGACGACAT AGTTGTCAAT GGCAATGGGA CAGAACCTGG
TCATGTTATT GTGACAAGCA TTGATGGAAG AAATGGACAG GCTAAACAGG TACTGTTCAC AAAACAAGCA CAAGTGATAT
TATGCTGATC CTTTTGTGTC CATTTAGTGT TGCCTGGGAA CACAATAAGT TTTTGTTCAC TGAATTATCT ATCTACATTG
CAGACCATTA GCTACATGGC CGAGCGTGTC GTAGGTCATG GATCCTTTGG AACTGTTTTC CAGGTTTGTC TTTAGACAGA
TCGATTTATG TTGCACTTGT TCAGTGTGTT AATTTGTGTG TTCTGGTGGC GATTGATGAA CCCTTCATTT CTTGAATGAT
CTTGTATAGG CCAAGTGCCT GGAAACCGGT GAGACTGTGG CTATAAAGAA GGTTCTTCAA GACAAGAGAT ATAAGAACCG
TGAGCTGCAA ACAATGCGAG TTCTTGACCA CCCAAATGTG GTGTCACTAA AGCATTGTTT TTTCTCAAAG ACTGAGAAGG
AGGAGCTTTA CCTCAATTTG GTGCTTGAGT ATGTGCCAGA GACTGCTCAC CGTGTAATTA AACATTACAA CAAGATGAAC
CAACGCATGC CATTGATATA TGCAAAACTA TACATGTATC AGGTAACGTT ACACACCTAG ATCTTCTAAT CTATCCTAGC
ACAATTATGC ATTGAGTATA ACATGGAAAA CCTATTATAA TTGACAGATA TGCAGAGCTT TGGCGTACAT TCACAACACC
ATTGGCGTGT GTCACAGGGA TATCAAGCCA CAAAATCTTC TGGTATGTTA CATACTTGCA TTTAGTTATA ATCTGTTTTC
CACTTATTGA AGCTTTGTGG AGTTAGTCAA GTACTAAGTT TTGTTTAGTC AGATGGTTGC TAAAAGATTA TTACTTCCAG
GTGAACCCAC ATACTCATCA GCTGAAATTA TGTGACTTCG GCAGCGCGAA AGTCTTGGTA TGATCACTCA TTACCAGATA
CTCACACGAA CATTGCCATT GTCTGTTGTA CCTAATCTTT TGTTCTATTA TTATAGGTAA AAGGAGAACC AAATATTTCT
TACATCTGTT CAAGGTACTA CAGAGCTCCA GAGCTCATAT TTGGTGCTAC TGAATACACA ACAGCGATTG ATGTTTGGTC
TGCCGGTTGT GTGCTTGCTG AACTCCTCCT GGGGCAGGTA AGAGATCACA TTATTTACAT GAGGCTTTTG GACCATCCAG
CTCATTGCAA CTGTCTGCCT AAGCTTTATC CTTTTTTTGT TTTAAAAGCC TCTATTCCCT GGCGACAGTG GCGTTGATCA
GCTTGTTGAA ATCATCAAGG TAAATTATAT CTTGCTTCCA TCGAAATCAC TCCCTTTTTG TTGTTTACCT CCTACTTAAC
TGACTATTCT CTCAGGTTCT GGGTACCCCT ACACGAGAGG AGATTAAGTG CATGAACCCA AATTACACCG AGTTTAAATT
TCCGCAAATC AAAGCTCACC CATGGCACAA GGTAGAAGAA AATAATCTTA TGTTGGACTG TTTATTTTTT ATTTTAGGGT
TGAAACCTAA TGTAGCTTTC CTTTTTTTTT ACCACCAGAT CTTCCATAAA AGAATGCCTG CTGAAGCAGT CGATCTCGTC
TCCAGGCTTT TGCAGTATTC ACCATACCTC CGGTCCACTG CTGTGAGTGT TGTCGTTGCA CTATTTGAGC CAACACCATT
TTTTAGAGAA AGTTTTAGTT CTTGGCATCA CTATTGTGTT ACATTTTTCT AATTACTTCA TCATACAAAC ATGCACTGCC
TTGCCAAGTA CTAGTAGTTA CAGATTGTGC ATTTCTTTAT TTGCCATTAC AGTCGGAAGC ATTGATCCAT CCCTTCTTCG
ATGAACTCCG TGATCCAAAC ACCCGCTTAC CGAACGGCCG TTTCCTTCCT CCTCTCTTCA ACTTCAAGCC CCATGGTAAG
CTTGCAACAC CGGCTGACAT ATGACATGCG TAGACGAAAA TTTCTGAACC ACCGATCAAC TTATAATTAT CTACTAATCT
GGCCGATTTG AACAGAACTG AAGGGTATGC CAATGGAATT CCTGGTGAAG CTTATCCCCG AACATGCTCG AAAGCAATGC
GCGTTTGTAG GATGGTGATT TCTGAGGTCA GCATGAAAAC TAGTTCAGAA TTTCTTCACC GTCCTCCATT AGAAAGCAGA
GATGAACCCT GTGTGCAGCC ATTTGGGAAA GCTGGTGCAT ATGGAAGTGG AACTACATTT TTTTGTCCGA GATTCTGACG
CCGCGTATTC TTTTCCCCCC TCCCACTTTG CTGCTGCCGG TGTAACCAAA AAATCATCCA CGGTTCTGTA AAGTTGATGA
AGAAGAGTGT AAAATCAGGT TGAAAACTGA ATTCGATCGG TTTGTCAAGA TTGTAGCAAC ATGCAAGGAA GGATGTTGCA
CACTTTGTAT GGCAATGTTC GTTCGGTCCA AATATTTGGA CATGGATCGA GAGGCTATTC ATTTAATTGT ACTTGCTGCT
ACATGTTCTT