Os05t0134000-03

Locus

Os05g0134000

Description

Similar to Shaggy-related protein kinase eta (EC 2.7.1.-) (ASK-eta) (BRASSINOSTEROID-INSENSITIVE 2) (ULTRACURVATA1).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSK13/OsGSK6, OsSK13, OsGSK6, SK13, GSK6

Oryzabase Gene Name Synonym(s)

Protein kinase-alfalfa (MSK-3) homolog, GSK3/SHAGGY-Like Kinase 13, GSK3-like Kinase 6

Transcript Evidence

AK121623 (DDBJ, Best hit)

AK058276 (DDBJ, Best hit)

Protein Evidence

Q1AMT7 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

J033045G07 (Online Clone Ordering)

001-013-C05 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0134000-03)

RiceXPro (AK121623)

Others

Oryzabase (17749)

KEGG (Os05t0134000-03 (EC:2.7.11.26))

Transcript

1882 bp

>Os05t0134000-03 Similar to Shaggy-related protein kinase eta (EC 2.7.1.-) (ASK-eta) (BRASSINOSTEROID-INSENSITIVE 2) (ULTRACURVATA1).
CTCCGAATCCTCCCCCGCATTCCGCGCCGGAGCTGAGGAGGGACAGCGAGCCAGCGAGGG
AGGTGGGGCAATCCAGCGAGCGCCAGATCGTGCCGCCAGCCCCGCTCCGTCCTCTCTCCG
GCGACCCTCCGCCCCGCCTGATCCCGTGGTGGATCAACTACAACTCATCTTTAGGAAAGC
CTCTTGAACATTAGCCTTGTGTGCCTTTCAACAGTATGGCCTCGGTAGGTGTGGTGCGTT
CTTCCTTGGGGTTTCAGAACGAAACAAGTACAAGTGGCGATGCCGACCGACTTCCGAATG
AGATGAGCAATATGAGTATAAGGGATGATAATAAGGACATTGACGACATAGTTGTCAATG
GCAATGGGACAGAACCTGGTCATGTTATTGTGACAAGCATTGATGGAAGAAATGGACAGG
CTAAACAGACCATTAGCTACATGGCCGAGCGTGTCGTAGGTCATGGATCCTTTGGAACTG
TTTTCCAGGCCAAGTGCCTGGAAACCGGTGAGACTGTGGCTATAAAGAAGGTTCTTCAAG
ACAAGAGATATAAGAACCGTGAGCTGCAAACAATGCGAGTTCTTGACCACCCAAATGTGG
TGTCACTAAAGCATTGTTTTTTCTCAAAGACTGAGAAGGAGGAGCTTTACCTCAATTTGG
TGCTTGAGTATGTGCCAGAGACTGCTCACCGTGTAATTAAACATTACAACAAGATGAACC
AACGCATGCCATTGATATATGCAAAACTATACATGTATCAGATATGCAGAGCTTTGGCGT
ACATTCACAACACCATTGGCGTGTGTCACAGGGATATCAAGCCACAAAATCTTCTGGTGA
ACCCACATACTCATCAGCTGAAATTATGTGACTTCGGCAGCGCGAAAGTCTTGGTAAAAG
GAGAACCAAATATTTCTTACATCTGTTCAAGGTACTACAGAGCTCCAGAGCTCATATTTG
GTGCTACTGAATACACAACAGCGATTGATGTTTGGTCTGCCGGTTGTGTGCTTGCTGAAC
TCCTCCTGGGGCAGCCTCTATTCCCTGGCGACAGTGGCGTTGATCAGCTTGTTGAAATCA
TCAAGGTTCTGGGTACCCCTACACGAGAGGAGATTAAGTGCATGAACCCAAATTACACCG
AGTTTAAATTTCCGCAAATCAAAGCTCACCCATGGCACAAGATCTTCCATAAAAGAATGC
CTGCTGAAGCAGTCGATCTCGTCTCCAGGCTTTTGCAGTATTCACCATACCTCCGGTCCA
CTGCTTCGGAAGCATTGATCCATCCCTTCTTCGATGAACTCCGTGATCCAAACACCCGCT
TACCGAACGGCCGTTTCCTTCCTCCTCTCTTCAACTTCAAGCCCCATGAACTGAAGGGTA
TGCCAATGGAATTCCTGGTGAAGCTTATCCCCGAACATGCTCGAAAGCAATGCGCGTTTG
TAGGATGGTGATTTCTGAGGTCAGCATGAAAACTAGTTCAGAATTTCTTCACCGTCCTCC
ATTAGAAAGCAGAGATGAACCCTGTGTGCAGCCATTTGGGAAAGCTGGTGCATATGGAAG
TGGAACTACATTTTTTTGTCCGAGATTCTGACGCCGCGTATTCTTTTCCCCCCTCCCACT
TTGCTGCTGCCGGTGTAACCAAAAAATCATCCACGGTTCTGTAAAGTTGATGAAGAAGAG
TGTAAAATCAGGTTGAAAACTGAATTCGATCGGTTTGTCAAGATTGTAGCAACATGCAAG
GAAGGATGTTGCACACTTTGTATGGCAATGTTCGTTCGGTCCAAATATTTGGACATGGAT
CGAGAGGCTATTCATTTAATTGTACTTGCTGCTACATGTTCTTACATATCAGTAATCTTC
TGAGAAGCTTGTGAAAGAAAGC

CDS

1236 bp

>Os05t0134000-03 Similar to Shaggy-related protein kinase eta (EC 2.7.1.-) (ASK-eta) (BRASSINOSTEROID-INSENSITIVE 2) (ULTRACURVATA1).
ATGGCCTCGGTAGGTGTGGTGCGTTCTTCCTTGGGGTTTCAGAACGAAACAAGTACAAGT
GGCGATGCCGACCGACTTCCGAATGAGATGAGCAATATGAGTATAAGGGATGATAATAAG
GACATTGACGACATAGTTGTCAATGGCAATGGGACAGAACCTGGTCATGTTATTGTGACA
AGCATTGATGGAAGAAATGGACAGGCTAAACAGACCATTAGCTACATGGCCGAGCGTGTC
GTAGGTCATGGATCCTTTGGAACTGTTTTCCAGGCCAAGTGCCTGGAAACCGGTGAGACT
GTGGCTATAAAGAAGGTTCTTCAAGACAAGAGATATAAGAACCGTGAGCTGCAAACAATG
CGAGTTCTTGACCACCCAAATGTGGTGTCACTAAAGCATTGTTTTTTCTCAAAGACTGAG
AAGGAGGAGCTTTACCTCAATTTGGTGCTTGAGTATGTGCCAGAGACTGCTCACCGTGTA
ATTAAACATTACAACAAGATGAACCAACGCATGCCATTGATATATGCAAAACTATACATG
TATCAGATATGCAGAGCTTTGGCGTACATTCACAACACCATTGGCGTGTGTCACAGGGAT
ATCAAGCCACAAAATCTTCTGGTGAACCCACATACTCATCAGCTGAAATTATGTGACTTC
GGCAGCGCGAAAGTCTTGGTAAAAGGAGAACCAAATATTTCTTACATCTGTTCAAGGTAC
TACAGAGCTCCAGAGCTCATATTTGGTGCTACTGAATACACAACAGCGATTGATGTTTGG
TCTGCCGGTTGTGTGCTTGCTGAACTCCTCCTGGGGCAGCCTCTATTCCCTGGCGACAGT
GGCGTTGATCAGCTTGTTGAAATCATCAAGGTTCTGGGTACCCCTACACGAGAGGAGATT
AAGTGCATGAACCCAAATTACACCGAGTTTAAATTTCCGCAAATCAAAGCTCACCCATGG
CACAAGATCTTCCATAAAAGAATGCCTGCTGAAGCAGTCGATCTCGTCTCCAGGCTTTTG
CAGTATTCACCATACCTCCGGTCCACTGCTTCGGAAGCATTGATCCATCCCTTCTTCGAT
GAACTCCGTGATCCAAACACCCGCTTACCGAACGGCCGTTTCCTTCCTCCTCTCTTCAAC
TTCAAGCCCCATGAACTGAAGGGTATGCCAATGGAATTCCTGGTGAAGCTTATCCCCGAA
CATGCTCGAAAGCAATGCGCGTTTGTAGGATGGTGA

Protein

412 aa

>Os05t0134000-03 Similar to Shaggy-related protein kinase eta (EC 2.7.1.-) (ASK-eta) (BRASSINOSTEROID-INSENSITIVE 2) (ULTRACURVATA1).
MASVGVVRSSLGFQNETSTSGDADRLPNEMSNMSIRDDNKDIDDIVVNGNGTEPGHVIVT
SIDGRNGQAKQTISYMAERVVGHGSFGTVFQAKCLETGETVAIKKVLQDKRYKNRELQTM
RVLDHPNVVSLKHCFFSKTEKEELYLNLVLEYVPETAHRVIKHYNKMNQRMPLIYAKLYM
YQICRALAYIHNTIGVCHRDIKPQNLLVNPHTHQLKLCDFGSAKVLVKGEPNISYICSRY
YRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGDSGVDQLVEIIKVLGTPTREEI
KCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPYLRSTASEALIHPFFD
ELRDPNTRLPNGRFLPPLFNFKPHELKGMPMEFLVKLIPEHARKQCAFVGW*

5'UTR

chr05:1977684..1977831 (- strand) : 148 bp

chr05:1976800..1976866 (- strand) : 67 bp

CDS

chr05:1976680..1976799 (- strand) : 120 bp

chr05:1976508..1976600 (- strand) : 93 bp

chr05:1976334..1976393 (- strand) : 60 bp

chr05:1975955..1976227 (- strand) : 273 bp

chr05:1975795..1975869 (- strand) : 75 bp

chr05:1975620..1975676 (- strand) : 57 bp

chr05:1975400..1975540 (- strand) : 141 bp

chr05:1975258..1975308 (- strand) : 51 bp

chr05:1975086..1975181 (- strand) : 96 bp

chr05:1974915..1974998 (- strand) : 84 bp

chr05:1974642..1974744 (- strand) : 103 bp

chr05:1974459..1974541 (- strand) : 83 bp

3'UTR

chr05:1974028..1974458 (- strand) : 431 bp

FASTA

>Os05t0134000-03 class=Sequence position=chr05:1974028..1977831 (- strand)
CTCCGAATCC TCCCCCGCAT TCCGCGCCGG AGCTGAGGAG GGACAGCGAG CCAGCGAGGG AGGTGGGGCA ATCCAGCGAG
CGCCAGATCG TGCCGCCAGC CCCGCTCCGT CCTCTCTCCG GCGACCCTCC GCCCCGCCTG ATCCCGTGGT AAATCCCTCT
CGCCTCTGTT TCTTGGATCC CGTGGTTCTT CTCTCTGCTT GTTCTTGCCC GATTCGACGG TTGACGCGGC CGTGGTTGCT
CTTGGATCGT GGCTTGGTTG GATTTTTCTT TTTCAAGGGG TGGAAGGGAA AGCTGGTTCT TTTTTTTTCC TTCTTTTTCT
TTTTTTTTTT TGGTGTGTGT GTTCGTTTGT TCTTGTGATT TTCTTGGGGG TGGGGAAGAT GGTGGCGGTT TCCGAGGTCG
GATCGGATAC TTGTTCGTCC TGCTGATTTT GCATTTTGAT CGGTGATTCT GGTGGCTTTC TTCTATTTGG ATGATGCGTG
TGATTGGAGG GAGATGAGTT GATGGGGGAA AGATGGTTTA GTTTGGTTGA TGCAAAATTT GGTGGTCTCT GGATCGGTGA
AATGTTCCCT TCTCTTGGCT GTTATGGATA GCAAGCATGG GTGGATGAAC TGGTTGATTC TTGAAAGCTA CCGCCTCGGG
ATAATCTCCC AATGATCGTG GTTGAAAATA TCATGATAAA CGGGGGGTAA TTGGTACAGA TTAGCATTCT AATATCTTCA
GATTCTGTGT TTCGATTGAG CTAGAAAAGT AACACTCCAG TTTTGATAAC AACTCGGCAT CCATCATGGA TTCCCAAAGT
TTCATTTCTT CTTTTTTTTT CTTTTCCTGT ACCTTCAAGC CTACCTGCCA ATTGCCAACA CAAACTGTCT GTGAATGTGC
TTCTGGCACC TAATCTCATC ACATCTTTCT TAAGTAAAAA CACTGTTGTG ACTTTGACTT ACCATTATTA TGCTGTTGTT
TGCAGGTGGA TCAACTACAA CTCATCTTTA GGAAAGCCTC TTGAACATTA GCCTTGTGTG CCTTTCAACA GTATGGCCTC
GGTAGGTGTG GTGCGTTCTT CCTTGGGGTT TCAGAACGAA ACAAGTACAA GTGGCGATGC CGACCGACTT CCGAATGAGA
TGAGCAATAT GAGTATAAGG GATGATAATA AGGTATTATG CCTAAGAGTG GTGGATCATA GTTGCCTTTT GCTGTATTGT
CAGTTGCTGA TTTGATTCAC AAACGTCGCA GGACATTGAC GACATAGTTG TCAATGGCAA TGGGACAGAA CCTGGTCATG
TTATTGTGAC AAGCATTGAT GGAAGAAATG GACAGGCTAA ACAGGTACTG TTCACAAAAC AAGCACAAGT GATATTATGC
TGATCCTTTT GTGTCCATTT AGTGTTGCCT GGGAACACAA TAAGTTTTTG TTCACTGAAT TATCTATCTA CATTGCAGAC
CATTAGCTAC ATGGCCGAGC GTGTCGTAGG TCATGGATCC TTTGGAACTG TTTTCCAGGT TTGTCTTTAG ACAGATCGAT
TTATGTTGCA CTTGTTCAGT GTGTTAATTT GTGTGTTCTG GTGGCGATTG ATGAACCCTT CATTTCTTGA ATGATCTTGT
ATAGGCCAAG TGCCTGGAAA CCGGTGAGAC TGTGGCTATA AAGAAGGTTC TTCAAGACAA GAGATATAAG AACCGTGAGC
TGCAAACAAT GCGAGTTCTT GACCACCCAA ATGTGGTGTC ACTAAAGCAT TGTTTTTTCT CAAAGACTGA GAAGGAGGAG
CTTTACCTCA ATTTGGTGCT TGAGTATGTG CCAGAGACTG CTCACCGTGT AATTAAACAT TACAACAAGA TGAACCAACG
CATGCCATTG ATATATGCAA AACTATACAT GTATCAGGTA ACGTTACACA CCTAGATCTT CTAATCTATC CTAGCACAAT
TATGCATTGA GTATAACATG GAAAACCTAT TATAATTGAC AGATATGCAG AGCTTTGGCG TACATTCACA ACACCATTGG
CGTGTGTCAC AGGGATATCA AGCCACAAAA TCTTCTGGTA TGTTACATAC TTGCATTTAG TTATAATCTG TTTTCCACTT
ATTGAAGCTT TGTGGAGTTA GTCAAGTACT AAGTTTTGTT TAGTCAGATG GTTGCTAAAA GATTATTACT TCCAGGTGAA
CCCACATACT CATCAGCTGA AATTATGTGA CTTCGGCAGC GCGAAAGTCT TGGTATGATC ACTCATTACC AGATACTCAC
ACGAACATTG CCATTGTCTG TTGTACCTAA TCTTTTGTTC TATTATTATA GGTAAAAGGA GAACCAAATA TTTCTTACAT
CTGTTCAAGG TACTACAGAG CTCCAGAGCT CATATTTGGT GCTACTGAAT ACACAACAGC GATTGATGTT TGGTCTGCCG
GTTGTGTGCT TGCTGAACTC CTCCTGGGGC AGGTAAGAGA TCACATTATT TACATGAGGC TTTTGGACCA TCCAGCTCAT
TGCAACTGTC TGCCTAAGCT TTATCCTTTT TTTGTTTTAA AAGCCTCTAT TCCCTGGCGA CAGTGGCGTT GATCAGCTTG
TTGAAATCAT CAAGGTAAAT TATATCTTGC TTCCATCGAA ATCACTCCCT TTTTGTTGTT TACCTCCTAC TTAACTGACT
ATTCTCTCAG GTTCTGGGTA CCCCTACACG AGAGGAGATT AAGTGCATGA ACCCAAATTA CACCGAGTTT AAATTTCCGC
AAATCAAAGC TCACCCATGG CACAAGGTAG AAGAAAATAA TCTTATGTTG GACTGTTTAT TTTTTATTTT AGGGTTGAAA
CCTAATGTAG CTTTCCTTTT TTTTTACCAC CAGATCTTCC ATAAAAGAAT GCCTGCTGAA GCAGTCGATC TCGTCTCCAG
GCTTTTGCAG TATTCACCAT ACCTCCGGTC CACTGCTGTG AGTGTTGTCG TTGCACTATT TGAGCCAACA CCATTTTTTA
GAGAAAGTTT TAGTTCTTGG CATCACTATT GTGTTACATT TTTCTAATTA CTTCATCATA CAAACATGCA CTGCCTTGCC
AAGTACTAGT AGTTACAGAT TGTGCATTTC TTTATTTGCC ATTACAGTCG GAAGCATTGA TCCATCCCTT CTTCGATGAA
CTCCGTGATC CAAACACCCG CTTACCGAAC GGCCGTTTCC TTCCTCCTCT CTTCAACTTC AAGCCCCATG GTAAGCTTGC
AACACCGGCT GACATATGAC ATGCGTAGAC GAAAATTTCT GAACCACCGA TCAACTTATA ATTATCTACT AATCTGGCCG
ATTTGAACAG AACTGAAGGG TATGCCAATG GAATTCCTGG TGAAGCTTAT CCCCGAACAT GCTCGAAAGC AATGCGCGTT
TGTAGGATGG TGATTTCTGA GGTCAGCATG AAAACTAGTT CAGAATTTCT TCACCGTCCT CCATTAGAAA GCAGAGATGA
ACCCTGTGTG CAGCCATTTG GGAAAGCTGG TGCATATGGA AGTGGAACTA CATTTTTTTG TCCGAGATTC TGACGCCGCG
TATTCTTTTC CCCCCTCCCA CTTTGCTGCT GCCGGTGTAA CCAAAAAATC ATCCACGGTT CTGTAAAGTT GATGAAGAAG
AGTGTAAAAT CAGGTTGAAA ACTGAATTCG ATCGGTTTGT CAAGATTGTA GCAACATGCA AGGAAGGATG TTGCACACTT
TGTATGGCAA TGTTCGTTCG GTCCAAATAT TTGGACATGG ATCGAGAGGC TATTCATTTA ATTGTACTTG CTGCTACATG
TTCTTACATA TCAGTAATCT TCTGAGAAGC TTGTGAAAGA AAGC