Os05t0139100-01

Locus

Os05g0139100

Description

Typical DNA-binding bHLH protein, Negative regulation of grain length and weight

RAP-DB Gene Symbol Synonym(s)

APG

RAP-DB Gene Name Synonym(s)

ANTAGONIST OF PGL1

CGSNL Gene Symbol

PIL16

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

APG, OsPIL16, OsbHLH106

Oryzabase Gene Name Synonym(s)

ANTAGONIST OF PGL1, PHYTOCHROME INTERACTING FACTOR-LIKE 16, basic helix-loop-helix protein 106

Transcript Evidence

AK287958

Protein Evidence

Q6AT90

Literature

PMID: 22363621

Note

Manual Curation

January 16, 2019

Gene Ontology (GO)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

Helix-loop-helix DNA-binding domain superfamily (IPR036638)

Myc-type, basic helix-loop-helix (bHLH) domain (IPR011598)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

J075053F01 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0139100-01)

Others

Oryzabase (14313)

KEGG (Os05t0139100-01)

Transcript

1793 bp

>Os05t0139100-01 Typical DNA-binding bHLH protein, Negative regulation of grain length and weight
GATTCTCCCGCCTCCGCCGCGCGCCGCCATCCATCCTCCTCTCCGGCGACCTCATCCGTC
TGCATGCTACGCGGGAACGACACCGGCAGCGACCTGGCCGAGCTGCTCTGGGACAACGGC
GCCCCGGCGCCGCTCAGGCCGCCTCCGCCTCCGCCCTTCCAGCCCTTCACCTGCAGCGCC
GCCGCCACCACGTCGCCGCCGGCGCACGACTACCTCTTCATCAAGAATCTCATGCGGGGC
GGCGGCGCCGCCAACCACCACCACCACGATGACGATGACGACGACGACGACGACGTGCCG
TGGTTGCATTACCACCCTGTCGTGGACGACGACGACGACGCCGACGCTGACACGGCGCCG
CTGCCTCCCGACTACTGCGCCGCCTTGCTCTCCGGCCTCTCCGACCACCTCCCGCCGCCC
GCCGCTGCGGCGAGCAGGGTGGACCCCGACCCCTGCTCCTCCTCCCACGGCGCCGTCGTC
CCGTCCACGTCCGCCGCCGCCGCCAAGCAGGCTCGCACGAGCGGCGGCGGCGGCGGCGGC
GTCATGAACTTCACCTTCTTCTCGAGGCCTCTGCAGCAGCGCCCCTCCGGCGGCGAGACC
GCGTCGGCGTCGGCGTCGGCGGCGGCCACCTCGACCGTCCCCGTCGAGTCGACGGTGGTG
CAGGCGGCGACGAACCGGCTGAGAAGCACCCCGCTCTTCTCCGACCAGAGGATGGCATGG
CTGCACCCGCCCAAGCCGTCGCCACGCGCCGCCGCACCGCCGCCGCCGCCGCCTCTGGCC
CCTACCACTCGGCACCGACTCGACACCGCCGCCGCGACGGCGACGGTGGCGCAGAGGTTG
CCGCCGTCCGAGGCAAGAGCTCCCGACGCGCCCCCGCCTGCCGCGACCGCGACGGCGACG
ACCTCGTCCGTCTGCTCCGGCAACGGCGACCGGAGACAGCTCAATTGGAGGGACAGCCAC
AACAACCAGTCCGCCGAGTGGTCGGCCAGTCAAGACGAGCTGGACCTCGACGACGAGCTC
GCAGGCGTCCACCGGAGGTCGGCGGCGAGGAGCTCCAAGCGCAGCCGCACCGCCGAAGTC
CACAACCTGTCAGAGCGGAGGAGAAGAGACCGGATCAACGAGAAGATGCGGGCGCTGCAA
GAGCTCATCCCAAACTGCAACAAGATTGACAAGGCGTCGATGCTGGAGGAAGCCATCGAG
TACCTCAAGACGCTGCAGCTGCAGGTGCAGATGATGTCGATGGGGACGGGGATGTTCGTG
CCGCCGATGATGCTGCCGGCGGCGGCGGCGGCAATGCAGCACCACCACATGCAGATGCAG
CAGATGGCCGGGCCAATGGCGGCGGCGGCGCATTTCccccacctcggcgccgccgccgcc
atggggctcgccggcttcggcatgcccgccgccgcgcagttcccttgcccgatgttcccc
gccgcgccgccgatgtccatgttcgcgccgccgccgccgccgccgccgttccctcacgcg
gccgccaccgccgtcgagcagacgccgtctccgCCGGGAGCAGCAGACGCCGGCAACGCC
CCCGCCGTGAAGCAGGCGTGACGGCCATCACATCTCTGCATTTGCAATCGCCAATTCGCC
ATTGCGGTGGCCTCGCCTAGCTTAGCTAGCTTTGATCTGAACAATTTTCAGTCTCACCTA
GCTTGCTGTAGCAGAAACGTTCCAACTTTGTTCTAGCTGTAGCTTTGTAGTTGTAAAATT
GAGGAAAATTTATGTAGATGAGCTACTGAAGTAGTAGTTCTTTTTTTGTTCGG

CDS

1518 bp

>Os05t0139100-01 Typical DNA-binding bHLH protein, Negative regulation of grain length and weight
ATGCTACGCGGGAACGACACCGGCAGCGACCTGGCCGAGCTGCTCTGGGACAACGGCGCC
CCGGCGCCGCTCAGGCCGCCTCCGCCTCCGCCCTTCCAGCCCTTCACCTGCAGCGCCGCC
GCCACCACGTCGCCGCCGGCGCACGACTACCTCTTCATCAAGAATCTCATGCGGGGCGGC
GGCGCCGCCAACCACCACCACCACGATGACGATGACGACGACGACGACGACGTGCCGTGG
TTGCATTACCACCCTGTCGTGGACGACGACGACGACGCCGACGCTGACACGGCGCCGCTG
CCTCCCGACTACTGCGCCGCCTTGCTCTCCGGCCTCTCCGACCACCTCCCGCCGCCCGCC
GCTGCGGCGAGCAGGGTGGACCCCGACCCCTGCTCCTCCTCCCACGGCGCCGTCGTCCCG
TCCACGTCCGCCGCCGCCGCCAAGCAGGCTCGCACGAGCGGCGGCGGCGGCGGCGGCGTC
ATGAACTTCACCTTCTTCTCGAGGCCTCTGCAGCAGCGCCCCTCCGGCGGCGAGACCGCG
TCGGCGTCGGCGTCGGCGGCGGCCACCTCGACCGTCCCCGTCGAGTCGACGGTGGTGCAG
GCGGCGACGAACCGGCTGAGAAGCACCCCGCTCTTCTCCGACCAGAGGATGGCATGGCTG
CACCCGCCCAAGCCGTCGCCACGCGCCGCCGCACCGCCGCCGCCGCCGCCTCTGGCCCCT
ACCACTCGGCACCGACTCGACACCGCCGCCGCGACGGCGACGGTGGCGCAGAGGTTGCCG
CCGTCCGAGGCAAGAGCTCCCGACGCGCCCCCGCCTGCCGCGACCGCGACGGCGACGACC
TCGTCCGTCTGCTCCGGCAACGGCGACCGGAGACAGCTCAATTGGAGGGACAGCCACAAC
AACCAGTCCGCCGAGTGGTCGGCCAGTCAAGACGAGCTGGACCTCGACGACGAGCTCGCA
GGCGTCCACCGGAGGTCGGCGGCGAGGAGCTCCAAGCGCAGCCGCACCGCCGAAGTCCAC
AACCTGTCAGAGCGGAGGAGAAGAGACCGGATCAACGAGAAGATGCGGGCGCTGCAAGAG
CTCATCCCAAACTGCAACAAGATTGACAAGGCGTCGATGCTGGAGGAAGCCATCGAGTAC
CTCAAGACGCTGCAGCTGCAGGTGCAGATGATGTCGATGGGGACGGGGATGTTCGTGCCG
CCGATGATGCTGCCGGCGGCGGCGGCGGCAATGCAGCACCACCACATGCAGATGCAGCAG
ATGGCCGGGCCAATGGCGGCGGCGGCGCATTTCccccacctcggcgccgccgccgccatg
gggctcgccggcttcggcatgcccgccgccgcgcagttcccttgcccgatgttccccgcc
gcgccgccgatgtccatgttcgcgccgccgccgccgccgccgccgttccctcacgcggcc
gccaccgccgtcgagcagacgccgtctccgCCGGGAGCAGCAGACGCCGGCAACGCCCCC
GCCGTGAAGCAGGCGTGA

Protein

506 aa

>Os05t0139100-01 Typical DNA-binding bHLH protein, Negative regulation of grain length and weight
MLRGNDTGSDLAELLWDNGAPAPLRPPPPPPFQPFTCSAAATTSPPAHDYLFIKNLMRGG
GAANHHHHDDDDDDDDDVPWLHYHPVVDDDDDADADTAPLPPDYCAALLSGLSDHLPPPA
AAASRVDPDPCSSSHGAVVPSTSAAAAKQARTSGGGGGGVMNFTFFSRPLQQRPSGGETA
SASASAAATSTVPVESTVVQAATNRLRSTPLFSDQRMAWLHPPKPSPRAAAPPPPPPLAP
TTRHRLDTAAATATVAQRLPPSEARAPDAPPPAATATATTSSVCSGNGDRRQLNWRDSHN
NQSAEWSASQDELDLDDELAGVHRRSAARSSKRSRTAEVHNLSERRRRDRINEKMRALQE
LIPNCNKIDKASMLEEAIEYLKTLQLQVQMMSMGTGMFVPPMMLPAAAAAMQHHHMQMQQ
MAGPMAAAAHFPHLGAAAAMGLAGFGMPAAAQFPCPMFPAAPPMSMFAPPPPPPPFPHAA
ATAVEQTPSPPGAADAGNAPAVKQA*

5'UTR

chr05:2246835..2246897 (+ strand) : 63 bp

CDS

chr05:2246898..2247833 (+ strand) : 936 bp

chr05:2247916..2248014 (+ strand) : 99 bp

chr05:2248105..2248170 (+ strand) : 66 bp

chr05:2248248..2248664 (+ strand) : 417 bp

3'UTR

chr05:2248665..2248876 (+ strand) : 212 bp

FASTA

>Os05t0139100-01 class=Sequence position=chr05:2246835..2248876 (+ strand)
GATTCTCCCG CCTCCGCCGC GCGCCGCCAT CCATCCTCCT CTCCGGCGAC CTCATCCGTC TGCATGCTAC GCGGGAACGA
CACCGGCAGC GACCTGGCCG AGCTGCTCTG GGACAACGGC GCCCCGGCGC CGCTCAGGCC GCCTCCGCCT CCGCCCTTCC
AGCCCTTCAC CTGCAGCGCC GCCGCCACCA CGTCGCCGCC GGCGCACGAC TACCTCTTCA TCAAGAATCT CATGCGGGGC
GGCGGCGCCG CCAACCACCA CCACCACGAT GACGATGACG ACGACGACGA CGACGTGCCG TGGTTGCATT ACCACCCTGT
CGTGGACGAC GACGACGACG CCGACGCTGA CACGGCGCCG CTGCCTCCCG ACTACTGCGC CGCCTTGCTC TCCGGCCTCT
CCGACCACCT CCCGCCGCCC GCCGCTGCGG CGAGCAGGGT GGACCCCGAC CCCTGCTCCT CCTCCCACGG CGCCGTCGTC
CCGTCCACGT CCGCCGCCGC CGCCAAGCAG GCTCGCACGA GCGGCGGCGG CGGCGGCGGC GTCATGAACT TCACCTTCTT
CTCGAGGCCT CTGCAGCAGC GCCCCTCCGG CGGCGAGACC GCGTCGGCGT CGGCGTCGGC GGCGGCCACC TCGACCGTCC
CCGTCGAGTC GACGGTGGTG CAGGCGGCGA CGAACCGGCT GAGAAGCACC CCGCTCTTCT CCGACCAGAG GATGGCATGG
CTGCACCCGC CCAAGCCGTC GCCACGCGCC GCCGCACCGC CGCCGCCGCC GCCTCTGGCC CCTACCACTC GGCACCGACT
CGACACCGCC GCCGCGACGG CGACGGTGGC GCAGAGGTTG CCGCCGTCCG AGGCAAGAGC TCCCGACGCG CCCCCGCCTG
CCGCGACCGC GACGGCGACG ACCTCGTCCG TCTGCTCCGG CAACGGCGAC CGGAGACAGC TCAATTGGAG GGACAGCCAC
AACAACCAGT CCGCCGAGTG GTCGGCCAGT CAAGACGAGG TAAGCAAACA ACCACGCCGC CGCCGCCGCC ATTGCTGCTC
GCGATCGCTC ACGCGTACGT CACGTCTCTC CCCCTCTCCA GCTGGACCTC GACGACGAGC TCGCAGGCGT CCACCGGAGG
TCGGCGGCGA GGAGCTCCAA GCGCAGCCGC ACCGCCGAAG TCCACAACCT GTCAGAGCGG GTAAGCACAC ACACCATGCA
CCATCCACAA CACCCGCGTC GTGTCATGAC GTCATCTCAT CTCGCCATTG AATTGCTTTC GAGCTCGCAG AGGAGAAGAG
ACCGGATCAA CGAGAAGATG CGGGCGCTGC AAGAGCTCAT CCCAAACTGC AACAAGGTAA CAAAGTTCGC CATGAATCCA
AATTGAGCTT GGTGAAATGT GACGTCATCA TGGGAATGGA AAATGGTTTA TAGATTGACA AGGCGTCGAT GCTGGAGGAA
GCCATCGAGT ACCTCAAGAC GCTGCAGCTG CAGGTGCAGA TGATGTCGAT GGGGACGGGG ATGTTCGTGC CGCCGATGAT
GCTGCCGGCG GCGGCGGCGG CAATGCAGCA CCACCACATG CAGATGCAGC AGATGGCCGG GCCAATGGCG GCGGCGGCGC
ATTTCcccca cctcggcgcc gccgccgcca tggggctcgc cggcttcggc atgcccgccg ccgcgcagtt cccttgcccg
atgttccccg ccgcgccgcc gatgtccatg ttcgcgccgc cgccgccgcc gccgccgttc cctcacgcgg ccgccaccgc
cgtcgagcag acgccgtctc cgCCGGGAGC AGCAGACGCC GGCAACGCCC CCGCCGTGAA GCAGGCGTGA CGGCCATCAC
ATCTCTGCAT TTGCAATCGC CAATTCGCCA TTGCGGTGGC CTCGCCTAGC TTAGCTAGCT TTGATCTGAA CAATTTTCAG
TCTCACCTAG CTTGCTGTAG CAGAAACGTT CCAACTTTGT TCTAGCTGTA GCTTTGTAGT TGTAAAATTG AGGAAAATTT
ATGTAGATGA GCTACTGAAG TAGTAGTTCT TTTTTTGTTC GG

Locus: Os05g0139100

Loading...

Locus: Os05g0139100

Loading...