Os05t0143500-01

Locus

Os05g0143500

Description

Similar to Mitogen-activated protein kinase 14.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsMPK14, MPK14

Oryzabase Gene Name Synonym(s)

mitogen-activated protein kinase 14

Transcript Evidence

AK099719 (DDBJ, Best hit)

Protein Evidence

B7E979 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

Full-length cDNA

J013088B06 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0143500-01)

Others

Oryzabase (18117)

Transcript

2713 bp

>Os05t0143500-01 Similar to Mitogen-activated protein kinase 14.
ACACCAAGAGAAAAATTTTTTTTCCAAGAAACGAAAGCGAAATCAACCTGCAATTACCAG
CATAAATCAATCAATCGGAAAAGCAGAGGCCACAACGATCTCTCTCTCCAGTCTCGACTC
CCCAGCTACCACCTCCTCTCCTCTCCTCTCTCCTCCATGAGCTTTGCCTAGATCACAGCT
GGATTTCTTGGCCGCATCCTCCTCTTCTTCCAGGTCTCTTCCAGCTAGCTAGCTTGTTCT
TCCCTTCCCTTTCTTTTTGCCTTGTGCGCGTGAGGATCAGTGAGCTGTGCGGCTCTCTTT
TCTTGTTCTTGCTGGACTGCTGCTGCCTTAAAAGATCCTGCCTTTCTTGCTCACTTTCCC
CGGAGGAGAGAGAGAGGAGATCCACATCTCTGATGGTTCTTGGGATCTCCTAGGAGTTGT
TTCTACCTGTGCTGCTGCTGCTGATTTCTTCTTCGATTTGCTAGCGGCTGTGTGGTCGGA
GCTCGTCTTCTTGGTTCGAGATCTCGACACCTTCTGAGATGGATTTTTTCACCGAGTACG
GTGAGGGAAACAGGTACAAGATAGAAGAGGTTATAGGAAAAGGGAGTTATGGTGTGGTTT
GCTCTGCTTTGGACACTCACACCGGTGATAAAGTTGCTATCAAGAAAATCAATGACATCT
TTGAGCATGTGTCCGATGCAACACGGATACTTCGCGAGATCAAGTTGCTTAGACTCCTGC
GACATCCGGATATCGTGGAAATTAAGCATATTCTACTTCCTCCATCAAGGAGAGAATTCA
AGGATATCTACGTTGTTTTTGAACTCATGGAGTCTGATTTGCACCAAGTTATAAAGGCCA
ACGATGACTTGACTCCTGAACACTACCAGTTTTTCTTGTATCAGTTGCTCCGAGGACTGA
AATATATACACACAGCTTTTTGCAGCAAATGTATTTCATCGAGATCTCAAACCAAAAAAT
ATCTTGGCGAATGCTGATTGTAAGCTCAAAATATGTGATTTCGGCCTTGCAAGGGTAGCT
TTTAGTGATACTCCAACCGCCATCTTCTGGACGGATTATATTGCAACAAGGTGGTACCGA
GCACCAGAGCTGTGTGGATCTTTTTTCTCCAAGTATACACCAGCAATAGATATATGGAGT
ATTGGCTGCATATTTGCCGAGCTTTTAACCGGAAAACCTCTTTTCCCTGGGAAGAATGTG
GTTCATCAACTTGATATAATTACAGATCTACTAGGAACACCTTCTCCAGAAACAATATCT
AGGATTAGAAATGAGAAGGCAAGACGTTACTTGAACAGTATGAGGCGGAAAAAACCTATA
CCATTTACACAGAAGTTCCCAAATGCAGATCCACTTGCAATGCGGTTGTTAGAGAGAATG
TTAGCTTTTGATCCAAAAGATCGGCCAAGTGCTGAGGAGGCGCTTGCTGATCCTTATTTC
AAGAACATAGCCAATGTTGATAGAGAGCCTTCTGCTCAACCTATCACAAAGCTAGAGTTT
GAGTTCGAGAGGCGGAGAATTACTAAGGAAGATATAAGGGAACTCATATATAGAGAAATT
CTGGAGTATCATCCAAAGATGCTGAGGGAGTTCCTTGAGGGAACTGAGTCCACTGGTTTC
ATGTACCCAAGTGCAGTAGACCATTTTAAAAAACAGTTTGCATACCTTGAAGAACATTAT
GCCAAGGGATCAACAGCAGCTCCACCTGAGAGACAACATAACTCATTACCAAGGCCTTGT
GTTGTCTATTCAGATAACCGGCCACAAAGCACAGCCAGTGTCACTGAGGATCTTTCCAGG
TGTTTAATCAGAGACAACAATCTAAAATCACAGGATTCTGCTTCAGTCGGTGCAAGCAGA
ATCCCTCAAGGTGCTGCTGCAAGACCTGGTAAAGCAGTTGGTTCGGTGCTGCGTTACGGT
AACTGTTCGACATCCGCTGCTGAGCAACAATATGAGCAGCGAAGGGTTGTTCGGAACCCA
GCAATTGCTCCAAACAGCAGTGTTCCTCTGGGGAGCTCATACCCCAGAAGAAACCAGACC
TGCAAGAGTGAAACAGGTGATGTTGAAAGGATCGATTCCAGCCAAACCGGTCCACCGAAG
CCATATGTGGCGAACAAACTGCCTGCTACCGTCGATGGTCGGAGTGGCCACTGGTAAATT
TCTGCAGCGCACCAGCGAAAACGCTAGTTATTACCACAGCATCAGCATGGGTTTATTGTT
CTATGTAGTAAATTCTTAGACATTTAAAACATGTCATTCTGTACAGACTTGTATTGTTTC
TTGGGGGCTTTTCCATGATAAAAACAGTAGAATTGTACTGCAAGCCCTAGTGGATTAGGC
TGCCTGTTTCTTCATTTCTTCATAGCTCAACCTCTGAATGATCTGGTACACAAACAAGAT
CTCATGGAATTGGACATCACATGATTCAGTTCGAAGGGGGTATAGTGGAAACTGGAAGCA
ACAAGTGGACTGTAACATTTTCTTGCTGAGAAAACAAGGGACTCTTTACTGACCTGACTG
ATGCTGCTATTCAATTTATTTTCCAAGTAAATCCGAAGAAGGATCATGTAAACAGCACAA
TGTTGGACATTGCTTTAGTATTTCGTTCTCAGGAACATTGTTCCCTTTGCAGAGCTAGGA
GCTGCAACTATGTACTACTATCTGACATTGCTGTAACTTGTAAAACTTAATTGCATTTCA
AGTATTTTCCCTC

CDS

459 bp

>Os05t0143500-01 Similar to Mitogen-activated protein kinase 14.
ATGGATTTTTTCACCGAGTACGGTGAGGGAAACAGGTACAAGATAGAAGAGGTTATAGGA
AAAGGGAGTTATGGTGTGGTTTGCTCTGCTTTGGACACTCACACCGGTGATAAAGTTGCT
ATCAAGAAAATCAATGACATCTTTGAGCATGTGTCCGATGCAACACGGATACTTCGCGAG
ATCAAGTTGCTTAGACTCCTGCGACATCCGGATATCGTGGAAATTAAGCATATTCTACTT
CCTCCATCAAGGAGAGAATTCAAGGATATCTACGTTGTTTTTGAACTCATGGAGTCTGAT
TTGCACCAAGTTATAAAGGCCAACGATGACTTGACTCCTGAACACTACCAGTTTTTCTTG
TATCAGTTGCTCCGAGGACTGAAATATATACACACAGCTTTTTGCAGCAAATGTATTTCA
TCGAGATCTCAAACCAAAAAATATCTTGGCGAATGCTGA

Protein

153 aa

>Os05t0143500-01 Similar to Mitogen-activated protein kinase 14.
MDFFTEYGEGNRYKIEEVIGKGSYGVVCSALDTHTGDKVAIKKINDIFEHVSDATRILRE
IKLLRLLRHPDIVEIKHILLPPSRREFKDIYVVFELMESDLHQVIKANDDLTPEHYQFFL
YQLLRGLKYIHTAFCSKCISSRSQTKKYLGEC*

5'UTR

chr05:2511547..2512052 (+ strand) : 506 bp

chr05:2512798..2512809 (+ strand) : 12 bp

CDS

chr05:2512810..2513206 (+ strand) : 397 bp

chr05:2514523..2514584 (+ strand) : 62 bp

3'UTR

chr05:2514585..2514660 (+ strand) : 76 bp

chr05:2514747..2514806 (+ strand) : 60 bp

chr05:2515684..2515833 (+ strand) : 150 bp

chr05:2515923..2516078 (+ strand) : 156 bp

chr05:2516172..2516383 (+ strand) : 212 bp

chr05:2516703..2516804 (+ strand) : 102 bp

chr05:2516914..2517050 (+ strand) : 137 bp

chr05:2517166..2518008 (+ strand) : 843 bp

FASTA

>Os05t0143500-01 class=Sequence position=chr05:2511547..2518008 (+ strand)
ACACCAAGAG AAAAATTTTT TTTCCAAGAA ACGAAAGCGA AATCAACCTG CAATTACCAG CATAAATCAA TCAATCGGAA
AAGCAGAGGC CACAACGATC TCTCTCTCCA GTCTCGACTC CCCAGCTACC ACCTCCTCTC CTCTCCTCTC TCCTCCATGA
GCTTTGCCTA GATCACAGCT GGATTTCTTG GCCGCATCCT CCTCTTCTTC CAGGTCTCTT CCAGCTAGCT AGCTTGTTCT
TCCCTTCCCT TTCTTTTTGC CTTGTGCGCG TGAGGATCAG TGAGCTGTGC GGCTCTCTTT TCTTGTTCTT GCTGGACTGC
TGCTGCCTTA AAAGATCCTG CCTTTCTTGC TCACTTTCCC CGGAGGAGAG AGAGAGGAGA TCCACATCTC TGATGGTTCT
TGGGATCTCC TAGGAGTTGT TTCTACCTGT GCTGCTGCTG CTGATTTCTT CTTCGATTTG CTAGCGGCTG TGTGGTCGGA
GCTCGTCTTC TTGGTTCGAG ATCTCGGTGA GTTGAAGCTG TGTGTTTTAT TTTTGGCTGA TCCATCTTGT TCTTGCTGTG
GCTGTTTATT TTTAGTTGGA TCCATTCAAT TTGGAGTTGA TGTGCTTTTT TTTTTTGGGT TTTCAAATTA AGGGGGTCAG
AAAAATCGGT ATTGTTGTTT TACAGATTCG TGAGCGCGAG TGCTTTTTCC AACAAATTTT TTTTAGTGTT TTTGAGTTTA
TTGGTTTGAG TATTTTTGAG TATATTGGCA GTTCTCTTGT CTCTTCGAGG AATGAAGTTT GCTGCGAATG GGATAATGTT
CATTGACTAT GTGCTGTGAA CTTTCCTTGG CGACTGTTAA TTGACCTCAA GTTATTGTCT TGTATGTTCA TATTTTTATC
TGATTTATGC AGTACATAAA TTTGCATCTT GTTATCCTGG ACTTGGAGAT ATGCGTACGT ATGGCCCCCA TCCATACACA
TCGTTGAATC ATGCGGTTCT GACCCCTAAG CAGTTTTTGA AATAAAAAAG AATATCACTT GATGTTATTT ATCCCCATAA
AAAAAGTAAC GCTTGCTGTT TTGCATCATA CATGATTGAC ATGGTATGTT GTTTCCGATG AAACCGCTTT CATACAGTAT
GATTTAGCTA ATGCCTTTAG GATGGTTGAC CTAATTGAAC AAAGGATTTT TTTTCTCATA CTAAAAAAAT TCTTTTGTCA
TACTAAAAGA ACTAGTCTGA TTCTGATCCA TTTTGTCTTT TTATGATTCA GACACCTTCT GAGATGGATT TTTTCACCGA
GTACGGTGAG GGAAACAGGT ACAAGATAGA AGAGGTTATA GGAAAAGGGA GTTATGGTGT GGTTTGCTCT GCTTTGGACA
CTCACACCGG TGATAAAGTT GCTATCAAGA AAATCAATGA CATCTTTGAG CATGTGTCCG ATGCAACACG GATACTTCGC
GAGATCAAGT TGCTTAGACT CCTGCGACAT CCGGATATCG TGGAAATTAA GCATATTCTA CTTCCTCCAT CAAGGAGAGA
ATTCAAGGAT ATCTACGTTG TTTTTGAACT CATGGAGTCT GATTTGCACC AAGTTATAAA GGCCAACGAT GACTTGACTC
CTGAACACTA CCAGTTTTTC TTGTATCAGT TGCTCCGAGG ACTGAAATAT ATACACACAG GTAATTGATT TATTTTCACA
TGAAAGATGG TTCTTTTGCA TTTCTTTCAG TAGCCTGCTG TGAAGAATGT TCTATTTAAA TAAATAAATT TGCTAAGGAC
AATTGCCACC ATGTTATAAC TGTTGCCAGA TAACAACCAA ACTATTTTTC TACTAGCAGA TTATTCTGGG ATTGTTCCTT
CAGCATTTGT GCTTTTTTGG GAACCTACAG TTTATCTGCA CAAACTATAT AATGAAAACA ATCTTATGGA ACTGTGGTTG
CTTTAGTACA AATAAACCAG CAGTACCCCA AAATTCTCCT GAAATGTGGA TCATTCTTGT GGGATGACTA GATGCCCCCT
GGCGCCCTTT GATGTAGAGT TTATAAAATC TGAAGTGTTA GCAAGCTTCC ATAGCGGGCA TCAACAGAAT CTTGTTGTCT
TCCTTTGCTT CCCAAGTTGT GGATACACTG AATTTGTGCC AGGATGGTAC AGCCTGAGGC ATTGGGTAGT TTAACCATCC
AAAAAATTAT TCATGGCATC CTGAAAGTAT AATGCATGTA ACTGCAACCT CATCTTCTAT CTGTACATGC TATTGACCAT
GGTTCTTACC TTCTGGCAAT ACAATATAAC AAATACTTTT CCTAGGGAAG AGGCTATGCT TGCTGCCCTT TGTGAAAAGT
CGAACAACTA GCTAACATCT TCCAATTGAA CTGGATTTGT TATCTGATAC ACATCTGCCA TGGTGCAAAC CGAGGTTTGG
GCTGTAATAA ACAAGGAATT TCATATTCTC TGGTTTCTTC ATCTTCTTAC CCTGGTTGTT TGTTGGCTTT GGTCAGACAA
CTTAGTTTGT TTTCAAAAGC AGAAGAACAA AGGCAAGCAC AAGTGTTTAC ATATATTTGA CACATTCCAG CATTCGTTGT
TCCTGATAGA CATACCCTTC ACATGAAGCA CCCTTTTGTG ACTAAGTTAG TTCTGTTCTT TAGGTTTTTT TATTAACCTG
ATTGTGATTG AATAGGATTT CCCTATTCAT TTTATACCAT GATAGAAACA TCTATCTTGC TTTGCTTCTA ATGATGCTGT
AAATAATGCA TGTGCTCATC CCCCATCCCC TCTTTTTTTC TAAATTATTC TAAGAAGTCA GTTTGACCAA TTTAGTACTT
TTGTTATATG AAAGGCTGAA AAATACAAAC GCACCATTCA GGAAAGGAAT AATAAGACGA GGACTACTAA CAGATTAATC
TTTTTTCTGT ACTCAGTGTT CTATGTTTGT GTGATTCCTA TTTATCAGTC CATCCTATTT GTGACTCTAA TTCCTGACTG
ATGCATCTTT TGATAGCTTT TTGCAGCAAA TGTATTTCAT CGAGATCTCA AACCAAAAAA TATCTTGGCG AATGCTGATT
GTAAGCTCAA AATATGTGAT TTCGGCCTTG CAAGGGTAGC TTTTAGTGAT ACTCCAACCG CCATCTTCTG GACGGTACGT
CATTTCACGC CCACTACACA CTATGCAGCT CATTACTCTT AAGATTTATA TCATCAGCTA ATTGATTTTT CTGTTTTTAG
GATTATATTG CAACAAGGTG GTACCGAGCA CCAGAGCTGT GTGGATCTTT TTTCTCCAAG GTTGTAATCA CATCTTTAAT
TTTATATTGG ATCATGATAT TCTGCAAAAA GAAATACATT GTTGTTCTTT TTACCTTTAT TAACCTGGGG CAGCGAAGCA
AACGTGGATA ACATTTCTTT AGGATTTTTA TCCAAACATA CTGTAAAGTA TTTTTTTTAT CTGAAGGGCA GCTTCTACCA
GTTAGACAAC ATGCCTTCTT GCTTAGGAAT TATTGACAGA TGAATGGAAT GTTTTTATTG GTTAGTAATG TTTTCTTATG
CATTTGATAG CTAGTGTTTC ATTGCCATTT ATGCCTCTTT ATGTTACTTT TCATGCCTAA TTTTGCTACT ATGTTCCTGG
CAACTTCCAT TTTGATTATG CTATTTTTGA ATTTTGTGAA CCAACTAATT AATGTCACAT AAAGTCATAT GTAATTGTAG
TTCATGCCAC TTGTGTCTAG TATTATTGAT GCCTGCAAAT AATTTGACAT ATTTTACAAC CTGAACTAGT GAACTACACA
AAGAGCCTCC CCGCCTTATG TCCTGACCAT ATAACCGTTT AAAATACCTT TTCCTTCACG AATGGTCCAA ATTGGGTTAC
CTAGTTTTTA TACAATGATC ATATGATAGG TTGGGTTTCA TATGCGTATC ATGATTTTTT TTTTTAAAAA AAACTGATTT
AACATCTAGA CATTGCCAAG CAAATAAAAC TGTTTTTGTT TTTATGACTT GTCTTCTTTC ATACAAGGAA TGCTGTGTAC
ACATGTATTC TCGCTGGGGA ATTTTTTTTT CGCCGGGAAG TGTACACATG TATTCTCCTT TTATTTTTTG CATGGGCTTC
TATGTTTGTC CAATATCCGA AGCACCGATG AACATAATGT GTTTCATTAT TTTGCAGTAT ACACCAGCAA TAGATATATG
GAGTATTGGC TGCATATTTG CCGAGCTTTT AACCGGAAAA CCTCTTTTCC CTGGGAAGAA TGTGGTTCAT CAACTTGATA
TAATTACAGA TCTACTAGGA ACACCTTCTC CAGAAACAAT ATCTAGGGTC AGTATGGATT GACTTCAAAA AATTGCTTAT
TACTTAGTTC CAATAAAATC CTATAATGCT TATATCTACA TTCACTTATG CAACAGATTA GAAATGAGAA GGCAAGACGT
TACTTGAACA GTATGAGGCG GAAAAAACCT ATACCATTTA CACAGAAGTT CCCAAATGCA GATCCACTTG CAATGCGGTT
GTTAGAGAGA ATGTTAGCTT TTGATCCAAA AGATCGGCCA AGTGCTGAGG AGGTATTGTC AGTATTAGCA TCAACCTTGC
ATCTTTTTTT TTTTTTGGTG TGTTATCTCA AGTGTCAGCA GCTAATGTAG CAGCCACATT TTCAGGCGCT TGCTGATCCT
TATTTCAAGA ACATAGCCAA TGTTGATAGA GAGCCTTCTG CTCAACCTAT CACAAAGCTA GAGTTTGAGT TCGAGAGGCG
GAGAATTACT AAGGAAGATA TAAGGGAACT CATATATAGA GAAATTCTGG AGTATCATCC AAAGATGCTG AGGGAGTTCC
TTGAGGGAAC TGAGTCCACT GGTTTCATGT ACCCAAGGTG TGTAGTCATG CCAAGTTTAT TTTTATTCCA TTGCTTTAAA
ATCTTCAACT GAGTTGTTCC TATTATAATT TCTGAGACAA TTTAGTGATC TTATTGTTGA ACTGCCAGGC CAGTTGTATG
TTGTTGAACA TGCTATATGT CCAGGTTAAC AATTAAATAA CAAATATTTA TGCGAATTGA CTGTTTTGTT GATGCACCGT
ATTAAGTAGT GATTACTTAT TTTAATTGCT CTATTTGTTG CTCGAAATCG ATTAGGCACG ACAAAAACTT GAGATAATTC
AAAGAACTAA GATCAATTAC TCTATTATGT TTACAGTGCA GTAGACCATT TTAAAAAACA GTTTGCATAC CTTGAAGAAC
ATTATGCCAA GGGATCAACA GCAGCTCCAC CTGAGAGACA ACATAACTCA TTACCAAGGT AAGATATTTA TTTTATTTTA
TTTTATATGA CATGGATTAA CCGATGGAAC TTGTAGCTCC AGTTGAATAT ATACTTGATT CTTGACTATC TACTATTGTA
TCGACAGGCC TTGTGTTGTC TATTCAGATA ACCGGCCACA AAGCACAGCC AGTGTCACTG AGGATCTTTC CAGGTGTTTA
ATCAGAGACA ACAATCTAAA ATCACAGGAT TCTGCTTCAG TCGGTGCAAG CAGAATCCCT CAAGGTTAGC ATCTGTCCTT
ACCAGTTGAC TTTAACCTGC AATTAAACTT GTATCCTCCA TTATATCTTT CATACATTGT GTGACTCAAG ATAGATTTTG
CACGTTACCT ATCTTCCAGG TGCTGCTGCA AGACCTGGTA AAGCAGTTGG TTCGGTGCTG CGTTACGGTA ACTGTTCGAC
ATCCGCTGCT GAGCAACAAT ATGAGCAGCG AAGGGTTGTT CGGAACCCAG CAATTGCTCC AAACAGCAGT GTTCCTCTGG
GGAGCTCATA CCCCAGAAGA AACCAGACCT GCAAGAGTGA AACAGGTGAT GTTGAAAGGA TCGATTCCAG CCAAACCGGT
CCACCGAAGC CATATGTGGC GAACAAACTG CCTGCTACCG TCGATGGTCG GAGTGGCCAC TGGTAAATTT CTGCAGCGCA
CCAGCGAAAA CGCTAGTTAT TACCACAGCA TCAGCATGGG TTTATTGTTC TATGTAGTAA ATTCTTAGAC ATTTAAAACA
TGTCATTCTG TACAGACTTG TATTGTTTCT TGGGGGCTTT TCCATGATAA AAACAGTAGA ATTGTACTGC AAGCCCTAGT
GGATTAGGCT GCCTGTTTCT TCATTTCTTC ATAGCTCAAC CTCTGAATGA TCTGGTACAC AAACAAGATC TCATGGAATT
GGACATCACA TGATTCAGTT CGAAGGGGGT ATAGTGGAAA CTGGAAGCAA CAAGTGGACT GTAACATTTT CTTGCTGAGA
AAACAAGGGA CTCTTTACTG ACCTGACTGA TGCTGCTATT CAATTTATTT TCCAAGTAAA TCCGAAGAAG GATCATGTAA
ACAGCACAAT GTTGGACATT GCTTTAGTAT TTCGTTCTCA GGAACATTGT TCCCTTTGCA GAGCTAGGAG CTGCAACTAT
GTACTACTAT CTGACATTGC TGTAACTTGT AAAACTTAAT TGCATTTCAA GTATTTTCCC TC

Locus: Os05g0143500

Loading...

Locus: Os05g0143500

Loading...