Os05t0143500-02

Locus

Os05g0143500

Description

Similar to Mitogen-activated protein kinase 14.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsMPK14, MPK14

Oryzabase Gene Name Synonym(s)

mitogen-activated protein kinase 14

Transcript Evidence

AK063944 (DDBJ, Best hit)

Protein Evidence

Q75KK8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: MAP kinase activity (GO:0004707)

Molecular Function: protein tyrosine kinase activity (GO:0004713)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

MAP kinase, conserved site (IPR003527)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

Tyrosine-protein kinase, catalytic domain (IPR020635)

Full-length cDNA

001-123-E08 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0143500-02)

RiceXPro (AK063944)

Others

Oryzabase (18117)

KEGG (Os05t0143500-02)

Transcript

2221 bp

>Os05t0143500-02 Similar to Mitogen-activated protein kinase 14.
CACAACGATCTCTCTCTCCAGTCTCGACTCCCCAGCTACCACCTCCTCTCCTCTCCTCTC
TCCTCCATGAGCTTTGCCTAGATCACAGCTGGATTTCTTGGCCGCATCCTCCTCTTCTTC
CAGGTCTCTTCCAGCTAGCTAGCTTGTTCTTCCCTTCCCTTTCTTTTTGCCTTGTGCGCG
TGAGGATCAGTGAGCTGTGCGGCTCTCTTTTCTTGTTCTTGCTGGACTGCTGCTGCCTTA
AAAGATCCTGCCTTTCTTGCTCACTTTCCCCGGAGGAGAGAGAGAGGAGATCCACATCTC
TGATGGTTCTTGGGATCTCCTAGGAGTTGTTTCTACCTGTGCTGCTGCTGCTGATTTCTT
CTTCGATTTGCTAGCGGCTGTGTGGTCGGAGCTCGTCTTCTTGGTTCGAGATCTCGACAC
CTTCTGAGATGGATTTTTTCACCGAGTACGGTGAGGGAAACAGGTACAAGATAGAAGAGG
TTATAGGAAAAGGGAGTTATGGTGTGGTTTGCTCTGCTTTGGACACTCACACCGGTGATA
AAGTTGCTATCAAGAAAATCAATGACATCTTTGAGCATGTGTCCGATGCAACACGGATAC
TTCGCGAGATCAAGTTGCTTAGACTCCTGCGACATCCGGATATCGTGGAAATTAAGCATA
TTCTACTTCCTCCATCAAGGAGAGAATTCAAGGATATCTACGTTGTTTTTGAACTCATGG
AGTCTGATTTGCACCAAGTTATAAAGGCCAACGATGACTTGACTCCTGAACACTACCAGT
TTTTCTTGTATCAGTTGCTCCGAGGACTGAAATATATACACACAGCAAATGTATTTCATC
GAGATCTCAAACCAAAAAATATCTTGGCGAATGCTGATTGTAAGCTCAAAATATGTGATT
TCGGCCTTGCAAGGGTAGCTTTTAGTGATACTCCAACCGCCATCTTCTGGACGGATTATA
TTGCAACAAGGTGGTACCGAGCACCAGAGCTGTGTGGATCTTTTTTCTCCAAGTATACAC
CAGCAATAGATATATGGAGTATTGGCTGCATATTTGCCGAGCTTTTAACCGGAAAACCTC
TTTTCCCTGGGAAGAATGTGGTTCATCAACTTGATATAATTACAGATCTACTAGGAACAC
CTTCTCCAGAAACAATATCTAGGATTAGAAATGAGAAGGCAAGACGTTACTTGAACAGTA
TGAGGCGGAAAAAACCTATACCATTTACACAGAAGTTCCCAAATGCAGATCCACTTGCAA
TGCGGTTGTTAGAGAGAATGTTAGCTTTTGATCCAAAAGATCGGCCAAGTGCTGAGGAGG
CGCTTGCTGATCCTTATTTCAAGAACATAGCCAATGTTGATAGAGAGCCTTCTGCTCAAC
CTATCACAAAGCTAGAGTTTGAGTTCGAGAGGCGGAGAATTACTAAGGAAGATATAAGGG
AACTCATATATAGAGAAATTCTGGAGTATCATCCAAAGATGCTGAGGGAGTTCCTTGAGG
GAACTGAGTCCACTGGTTTCATGTACCCAAGTGCAGTAGACCATTTTAAAAAACAGTTTG
CATACCTTGAAGAACATTATGCCAAGGGATCAACAGCAGCTCCACCTGAGAGACAACATA
ACTCATTACCAAGGCCTTGTGTTGTCTATTCAGATAACCGGCCACAAAGCACAGCCAGTG
TCACTGAGGATCTTTCCAGGTGTTTAATCAGAGACAACAATCTAAAATCACAGGATTCTG
CTTCAGTCGGTGCAAGCAGAATCCCTCAAGGTGCTGCTGCAAGACCTGGTAAAGCAGTTG
GTTCGGTGCTGCGTTACGGTAACTGTTCGACATCCGCTGCTGAGCAACAATATGAGCAGC
GAAGGGTTGTTCGGAACCCAGCAATTGCTCCAAACAGCAGTGTTCCTCTGGGGAGCTCAT
ACCCCAGAAGAAACCAGACCTGCAAGAGTGAAACAGGTGATGTTGAAAGGATCGATTCCA
GCCAAACCGGTCCACCGAAGCCATATGTGGCGAACAAACTGCCTGCTACCGTCGATGGTC
GGAGTGGCCACTGGTAAATTTCTGCAGCGCACCAGCGAAAACGCTAGTTATTACCACAGC
ATCAGCATGGGTTTATTGTTCTATGTAGTAAATTCTTAGACATTTAAAACATGTCATTCT
GTACAGACTTGTATTGTTTCTTGGGGGCTTTTCCATGATAAAAACAGTAGAATTGTACTG
C

CDS

1629 bp

>Os05t0143500-02 Similar to Mitogen-activated protein kinase 14.
ATGGATTTTTTCACCGAGTACGGTGAGGGAAACAGGTACAAGATAGAAGAGGTTATAGGA
AAAGGGAGTTATGGTGTGGTTTGCTCTGCTTTGGACACTCACACCGGTGATAAAGTTGCT
ATCAAGAAAATCAATGACATCTTTGAGCATGTGTCCGATGCAACACGGATACTTCGCGAG
ATCAAGTTGCTTAGACTCCTGCGACATCCGGATATCGTGGAAATTAAGCATATTCTACTT
CCTCCATCAAGGAGAGAATTCAAGGATATCTACGTTGTTTTTGAACTCATGGAGTCTGAT
TTGCACCAAGTTATAAAGGCCAACGATGACTTGACTCCTGAACACTACCAGTTTTTCTTG
TATCAGTTGCTCCGAGGACTGAAATATATACACACAGCAAATGTATTTCATCGAGATCTC
AAACCAAAAAATATCTTGGCGAATGCTGATTGTAAGCTCAAAATATGTGATTTCGGCCTT
GCAAGGGTAGCTTTTAGTGATACTCCAACCGCCATCTTCTGGACGGATTATATTGCAACA
AGGTGGTACCGAGCACCAGAGCTGTGTGGATCTTTTTTCTCCAAGTATACACCAGCAATA
GATATATGGAGTATTGGCTGCATATTTGCCGAGCTTTTAACCGGAAAACCTCTTTTCCCT
GGGAAGAATGTGGTTCATCAACTTGATATAATTACAGATCTACTAGGAACACCTTCTCCA
GAAACAATATCTAGGATTAGAAATGAGAAGGCAAGACGTTACTTGAACAGTATGAGGCGG
AAAAAACCTATACCATTTACACAGAAGTTCCCAAATGCAGATCCACTTGCAATGCGGTTG
TTAGAGAGAATGTTAGCTTTTGATCCAAAAGATCGGCCAAGTGCTGAGGAGGCGCTTGCT
GATCCTTATTTCAAGAACATAGCCAATGTTGATAGAGAGCCTTCTGCTCAACCTATCACA
AAGCTAGAGTTTGAGTTCGAGAGGCGGAGAATTACTAAGGAAGATATAAGGGAACTCATA
TATAGAGAAATTCTGGAGTATCATCCAAAGATGCTGAGGGAGTTCCTTGAGGGAACTGAG
TCCACTGGTTTCATGTACCCAAGTGCAGTAGACCATTTTAAAAAACAGTTTGCATACCTT
GAAGAACATTATGCCAAGGGATCAACAGCAGCTCCACCTGAGAGACAACATAACTCATTA
CCAAGGCCTTGTGTTGTCTATTCAGATAACCGGCCACAAAGCACAGCCAGTGTCACTGAG
GATCTTTCCAGGTGTTTAATCAGAGACAACAATCTAAAATCACAGGATTCTGCTTCAGTC
GGTGCAAGCAGAATCCCTCAAGGTGCTGCTGCAAGACCTGGTAAAGCAGTTGGTTCGGTG
CTGCGTTACGGTAACTGTTCGACATCCGCTGCTGAGCAACAATATGAGCAGCGAAGGGTT
GTTCGGAACCCAGCAATTGCTCCAAACAGCAGTGTTCCTCTGGGGAGCTCATACCCCAGA
AGAAACCAGACCTGCAAGAGTGAAACAGGTGATGTTGAAAGGATCGATTCCAGCCAAACC
GGTCCACCGAAGCCATATGTGGCGAACAAACTGCCTGCTACCGTCGATGGTCGGAGTGGC
CACTGGTAA

Protein

543 aa

>Os05t0143500-02 Similar to Mitogen-activated protein kinase 14.
MDFFTEYGEGNRYKIEEVIGKGSYGVVCSALDTHTGDKVAIKKINDIFEHVSDATRILRE
IKLLRLLRHPDIVEIKHILLPPSRREFKDIYVVFELMESDLHQVIKANDDLTPEHYQFFL
YQLLRGLKYIHTANVFHRDLKPKNILANADCKLKICDFGLARVAFSDTPTAIFWTDYIAT
RWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIITDLLGTPSP
ETISRIRNEKARRYLNSMRRKKPIPFTQKFPNADPLAMRLLERMLAFDPKDRPSAEEALA
DPYFKNIANVDREPSAQPITKLEFEFERRRITKEDIRELIYREILEYHPKMLREFLEGTE
STGFMYPSAVDHFKKQFAYLEEHYAKGSTAAPPERQHNSLPRPCVVYSDNRPQSTASVTE
DLSRCLIRDNNLKSQDSASVGASRIPQGAAARPGKAVGSVLRYGNCSTSAAEQQYEQRRV
VRNPAIAPNSSVPLGSSYPRRNQTCKSETGDVERIDSSQTGPPKPYVANKLPATVDGRSG
HW*

5'UTR

chr05:2511637..2512052 (+ strand) : 416 bp

chr05:2512798..2512809 (+ strand) : 12 bp

CDS

chr05:2512810..2513206 (+ strand) : 397 bp

chr05:2514533..2514660 (+ strand) : 128 bp

chr05:2514747..2514806 (+ strand) : 60 bp

chr05:2515684..2515833 (+ strand) : 150 bp

chr05:2515923..2516078 (+ strand) : 156 bp

chr05:2516172..2516383 (+ strand) : 212 bp

chr05:2516703..2516804 (+ strand) : 102 bp

chr05:2516914..2517050 (+ strand) : 137 bp

chr05:2517166..2517452 (+ strand) : 287 bp

3'UTR

chr05:2517453..2517616 (+ strand) : 164 bp

FASTA

>Os05t0143500-02 class=Sequence position=chr05:2511637..2517616 (+ strand)
CACAACGATC TCTCTCTCCA GTCTCGACTC CCCAGCTACC ACCTCCTCTC CTCTCCTCTC TCCTCCATGA GCTTTGCCTA
GATCACAGCT GGATTTCTTG GCCGCATCCT CCTCTTCTTC CAGGTCTCTT CCAGCTAGCT AGCTTGTTCT TCCCTTCCCT
TTCTTTTTGC CTTGTGCGCG TGAGGATCAG TGAGCTGTGC GGCTCTCTTT TCTTGTTCTT GCTGGACTGC TGCTGCCTTA
AAAGATCCTG CCTTTCTTGC TCACTTTCCC CGGAGGAGAG AGAGAGGAGA TCCACATCTC TGATGGTTCT TGGGATCTCC
TAGGAGTTGT TTCTACCTGT GCTGCTGCTG CTGATTTCTT CTTCGATTTG CTAGCGGCTG TGTGGTCGGA GCTCGTCTTC
TTGGTTCGAG ATCTCGGTGA GTTGAAGCTG TGTGTTTTAT TTTTGGCTGA TCCATCTTGT TCTTGCTGTG GCTGTTTATT
TTTAGTTGGA TCCATTCAAT TTGGAGTTGA TGTGCTTTTT TTTTTTGGGT TTTCAAATTA AGGGGGTCAG AAAAATCGGT
ATTGTTGTTT TACAGATTCG TGAGCGCGAG TGCTTTTTCC AACAAATTTT TTTTAGTGTT TTTGAGTTTA TTGGTTTGAG
TATTTTTGAG TATATTGGCA GTTCTCTTGT CTCTTCGAGG AATGAAGTTT GCTGCGAATG GGATAATGTT CATTGACTAT
GTGCTGTGAA CTTTCCTTGG CGACTGTTAA TTGACCTCAA GTTATTGTCT TGTATGTTCA TATTTTTATC TGATTTATGC
AGTACATAAA TTTGCATCTT GTTATCCTGG ACTTGGAGAT ATGCGTACGT ATGGCCCCCA TCCATACACA TCGTTGAATC
ATGCGGTTCT GACCCCTAAG CAGTTTTTGA AATAAAAAAG AATATCACTT GATGTTATTT ATCCCCATAA AAAAAGTAAC
GCTTGCTGTT TTGCATCATA CATGATTGAC ATGGTATGTT GTTTCCGATG AAACCGCTTT CATACAGTAT GATTTAGCTA
ATGCCTTTAG GATGGTTGAC CTAATTGAAC AAAGGATTTT TTTTCTCATA CTAAAAAAAT TCTTTTGTCA TACTAAAAGA
ACTAGTCTGA TTCTGATCCA TTTTGTCTTT TTATGATTCA GACACCTTCT GAGATGGATT TTTTCACCGA GTACGGTGAG
GGAAACAGGT ACAAGATAGA AGAGGTTATA GGAAAAGGGA GTTATGGTGT GGTTTGCTCT GCTTTGGACA CTCACACCGG
TGATAAAGTT GCTATCAAGA AAATCAATGA CATCTTTGAG CATGTGTCCG ATGCAACACG GATACTTCGC GAGATCAAGT
TGCTTAGACT CCTGCGACAT CCGGATATCG TGGAAATTAA GCATATTCTA CTTCCTCCAT CAAGGAGAGA ATTCAAGGAT
ATCTACGTTG TTTTTGAACT CATGGAGTCT GATTTGCACC AAGTTATAAA GGCCAACGAT GACTTGACTC CTGAACACTA
CCAGTTTTTC TTGTATCAGT TGCTCCGAGG ACTGAAATAT ATACACACAG GTAATTGATT TATTTTCACA TGAAAGATGG
TTCTTTTGCA TTTCTTTCAG TAGCCTGCTG TGAAGAATGT TCTATTTAAA TAAATAAATT TGCTAAGGAC AATTGCCACC
ATGTTATAAC TGTTGCCAGA TAACAACCAA ACTATTTTTC TACTAGCAGA TTATTCTGGG ATTGTTCCTT CAGCATTTGT
GCTTTTTTGG GAACCTACAG TTTATCTGCA CAAACTATAT AATGAAAACA ATCTTATGGA ACTGTGGTTG CTTTAGTACA
AATAAACCAG CAGTACCCCA AAATTCTCCT GAAATGTGGA TCATTCTTGT GGGATGACTA GATGCCCCCT GGCGCCCTTT
GATGTAGAGT TTATAAAATC TGAAGTGTTA GCAAGCTTCC ATAGCGGGCA TCAACAGAAT CTTGTTGTCT TCCTTTGCTT
CCCAAGTTGT GGATACACTG AATTTGTGCC AGGATGGTAC AGCCTGAGGC ATTGGGTAGT TTAACCATCC AAAAAATTAT
TCATGGCATC CTGAAAGTAT AATGCATGTA ACTGCAACCT CATCTTCTAT CTGTACATGC TATTGACCAT GGTTCTTACC
TTCTGGCAAT ACAATATAAC AAATACTTTT CCTAGGGAAG AGGCTATGCT TGCTGCCCTT TGTGAAAAGT CGAACAACTA
GCTAACATCT TCCAATTGAA CTGGATTTGT TATCTGATAC ACATCTGCCA TGGTGCAAAC CGAGGTTTGG GCTGTAATAA
ACAAGGAATT TCATATTCTC TGGTTTCTTC ATCTTCTTAC CCTGGTTGTT TGTTGGCTTT GGTCAGACAA CTTAGTTTGT
TTTCAAAAGC AGAAGAACAA AGGCAAGCAC AAGTGTTTAC ATATATTTGA CACATTCCAG CATTCGTTGT TCCTGATAGA
CATACCCTTC ACATGAAGCA CCCTTTTGTG ACTAAGTTAG TTCTGTTCTT TAGGTTTTTT TATTAACCTG ATTGTGATTG
AATAGGATTT CCCTATTCAT TTTATACCAT GATAGAAACA TCTATCTTGC TTTGCTTCTA ATGATGCTGT AAATAATGCA
TGTGCTCATC CCCCATCCCC TCTTTTTTTC TAAATTATTC TAAGAAGTCA GTTTGACCAA TTTAGTACTT TTGTTATATG
AAAGGCTGAA AAATACAAAC GCACCATTCA GGAAAGGAAT AATAAGACGA GGACTACTAA CAGATTAATC TTTTTTCTGT
ACTCAGTGTT CTATGTTTGT GTGATTCCTA TTTATCAGTC CATCCTATTT GTGACTCTAA TTCCTGACTG ATGCATCTTT
TGATAGCTTT TTGCAGCAAA TGTATTTCAT CGAGATCTCA AACCAAAAAA TATCTTGGCG AATGCTGATT GTAAGCTCAA
AATATGTGAT TTCGGCCTTG CAAGGGTAGC TTTTAGTGAT ACTCCAACCG CCATCTTCTG GACGGTACGT CATTTCACGC
CCACTACACA CTATGCAGCT CATTACTCTT AAGATTTATA TCATCAGCTA ATTGATTTTT CTGTTTTTAG GATTATATTG
CAACAAGGTG GTACCGAGCA CCAGAGCTGT GTGGATCTTT TTTCTCCAAG GTTGTAATCA CATCTTTAAT TTTATATTGG
ATCATGATAT TCTGCAAAAA GAAATACATT GTTGTTCTTT TTACCTTTAT TAACCTGGGG CAGCGAAGCA AACGTGGATA
ACATTTCTTT AGGATTTTTA TCCAAACATA CTGTAAAGTA TTTTTTTTAT CTGAAGGGCA GCTTCTACCA GTTAGACAAC
ATGCCTTCTT GCTTAGGAAT TATTGACAGA TGAATGGAAT GTTTTTATTG GTTAGTAATG TTTTCTTATG CATTTGATAG
CTAGTGTTTC ATTGCCATTT ATGCCTCTTT ATGTTACTTT TCATGCCTAA TTTTGCTACT ATGTTCCTGG CAACTTCCAT
TTTGATTATG CTATTTTTGA ATTTTGTGAA CCAACTAATT AATGTCACAT AAAGTCATAT GTAATTGTAG TTCATGCCAC
TTGTGTCTAG TATTATTGAT GCCTGCAAAT AATTTGACAT ATTTTACAAC CTGAACTAGT GAACTACACA AAGAGCCTCC
CCGCCTTATG TCCTGACCAT ATAACCGTTT AAAATACCTT TTCCTTCACG AATGGTCCAA ATTGGGTTAC CTAGTTTTTA
TACAATGATC ATATGATAGG TTGGGTTTCA TATGCGTATC ATGATTTTTT TTTTTAAAAA AAACTGATTT AACATCTAGA
CATTGCCAAG CAAATAAAAC TGTTTTTGTT TTTATGACTT GTCTTCTTTC ATACAAGGAA TGCTGTGTAC ACATGTATTC
TCGCTGGGGA ATTTTTTTTT CGCCGGGAAG TGTACACATG TATTCTCCTT TTATTTTTTG CATGGGCTTC TATGTTTGTC
CAATATCCGA AGCACCGATG AACATAATGT GTTTCATTAT TTTGCAGTAT ACACCAGCAA TAGATATATG GAGTATTGGC
TGCATATTTG CCGAGCTTTT AACCGGAAAA CCTCTTTTCC CTGGGAAGAA TGTGGTTCAT CAACTTGATA TAATTACAGA
TCTACTAGGA ACACCTTCTC CAGAAACAAT ATCTAGGGTC AGTATGGATT GACTTCAAAA AATTGCTTAT TACTTAGTTC
CAATAAAATC CTATAATGCT TATATCTACA TTCACTTATG CAACAGATTA GAAATGAGAA GGCAAGACGT TACTTGAACA
GTATGAGGCG GAAAAAACCT ATACCATTTA CACAGAAGTT CCCAAATGCA GATCCACTTG CAATGCGGTT GTTAGAGAGA
ATGTTAGCTT TTGATCCAAA AGATCGGCCA AGTGCTGAGG AGGTATTGTC AGTATTAGCA TCAACCTTGC ATCTTTTTTT
TTTTTTGGTG TGTTATCTCA AGTGTCAGCA GCTAATGTAG CAGCCACATT TTCAGGCGCT TGCTGATCCT TATTTCAAGA
ACATAGCCAA TGTTGATAGA GAGCCTTCTG CTCAACCTAT CACAAAGCTA GAGTTTGAGT TCGAGAGGCG GAGAATTACT
AAGGAAGATA TAAGGGAACT CATATATAGA GAAATTCTGG AGTATCATCC AAAGATGCTG AGGGAGTTCC TTGAGGGAAC
TGAGTCCACT GGTTTCATGT ACCCAAGGTG TGTAGTCATG CCAAGTTTAT TTTTATTCCA TTGCTTTAAA ATCTTCAACT
GAGTTGTTCC TATTATAATT TCTGAGACAA TTTAGTGATC TTATTGTTGA ACTGCCAGGC CAGTTGTATG TTGTTGAACA
TGCTATATGT CCAGGTTAAC AATTAAATAA CAAATATTTA TGCGAATTGA CTGTTTTGTT GATGCACCGT ATTAAGTAGT
GATTACTTAT TTTAATTGCT CTATTTGTTG CTCGAAATCG ATTAGGCACG ACAAAAACTT GAGATAATTC AAAGAACTAA
GATCAATTAC TCTATTATGT TTACAGTGCA GTAGACCATT TTAAAAAACA GTTTGCATAC CTTGAAGAAC ATTATGCCAA
GGGATCAACA GCAGCTCCAC CTGAGAGACA ACATAACTCA TTACCAAGGT AAGATATTTA TTTTATTTTA TTTTATATGA
CATGGATTAA CCGATGGAAC TTGTAGCTCC AGTTGAATAT ATACTTGATT CTTGACTATC TACTATTGTA TCGACAGGCC
TTGTGTTGTC TATTCAGATA ACCGGCCACA AAGCACAGCC AGTGTCACTG AGGATCTTTC CAGGTGTTTA ATCAGAGACA
ACAATCTAAA ATCACAGGAT TCTGCTTCAG TCGGTGCAAG CAGAATCCCT CAAGGTTAGC ATCTGTCCTT ACCAGTTGAC
TTTAACCTGC AATTAAACTT GTATCCTCCA TTATATCTTT CATACATTGT GTGACTCAAG ATAGATTTTG CACGTTACCT
ATCTTCCAGG TGCTGCTGCA AGACCTGGTA AAGCAGTTGG TTCGGTGCTG CGTTACGGTA ACTGTTCGAC ATCCGCTGCT
GAGCAACAAT ATGAGCAGCG AAGGGTTGTT CGGAACCCAG CAATTGCTCC AAACAGCAGT GTTCCTCTGG GGAGCTCATA
CCCCAGAAGA AACCAGACCT GCAAGAGTGA AACAGGTGAT GTTGAAAGGA TCGATTCCAG CCAAACCGGT CCACCGAAGC
CATATGTGGC GAACAAACTG CCTGCTACCG TCGATGGTCG GAGTGGCCAC TGGTAAATTT CTGCAGCGCA CCAGCGAAAA
CGCTAGTTAT TACCACAGCA TCAGCATGGG TTTATTGTTC TATGTAGTAA ATTCTTAGAC ATTTAAAACA TGTCATTCTG
TACAGACTTG TATTGTTTCT TGGGGGCTTT TCCATGATAA AAACAGTAGA ATTGTACTGC 

Locus: Os05g0143500

Loading...

Locus: Os05g0143500

Loading...