Os05t0143500-03

Locus

Os05g0143500

Description

Similar to Kinase (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsMPK14, MPK14

Oryzabase Gene Name Synonym(s)

mitogen-activated protein kinase 14

Transcript Evidence

AK061851 (DDBJ, Best hit)

Protein Evidence

C4PE55 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

001-040-F08 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0143500-03)

RiceXPro (AK061851)

Others

Oryzabase (18117)

KEGG (Os05t0143500-03)

Transcript

1141 bp

>Os05t0143500-03 Similar to Kinase (Fragment).
CCAAAGATGCTGAGGGAGTTCCTTGAGGGAACTGAGTCCACTGGTTTCATGTACCCAAGT
GCAGTAGACCATTTTAAAAAACAGTTTGCATACCTTGAAGAACATTATGCCAAGGGATCA
ACAGCAGCTCCACCTGAGAGACAACATAACTCATTACCAAGGCCTTGTGTTGTCTATTCA
GATAACCGGCCACAAAGCACAGCCAGTGTCACTGAGGATCTTTCCAGGTGTTTAATCAGA
GACAACAATCTAAAATCACAGGATTCTGCTTCAGTCGGTGCAAGCAGAATCCCTCAAGGT
GCTGCTGCAAGACCTGGTAAAGCAGTTGGTTCGGTGCTGCGTTACGGTAACTGTTCGACA
TCCGCTGCTGAGCAACAATATGAGCAGCGAAGGGTTGTTCGGAACCCAGCAATTGCTCCA
AACAGCAGTGTTCCTCTGGGGAGCTCATACCCCAGAAGAAACCAGACCTGCAAGAGTGAA
ACAGGTGATGTTGAAAGGATCGATTCCAGCCAAACCGGTCCACCGAAGCCATATGTGGCG
AACAAACTGCCTGCTACCGTCGATGGTCGGAGTGGCCACTGGTAAATTTCTGCAGCGCAC
CAGCGAAAACGCTAGTTATTACCACAGCATCAGCATGGGTTTATTGTTCTATGTAGTAAA
TTCTTAGACATTTAAAACATGTCATTCTGTACAGACTTGTATTGTTTCTTGGGGGCTTTT
CCATGATAAAAACAGTAGAATTGTACTGCAAGCCCTAGTGGATTAGGCTGCCTGTTTCTT
CATTTCTTCATAGCTCAACCTCTGAATGATCTGGTACACAAACAAGATCTCATGGAATTG
GACATCACATGATTCAGTTCGAAGGGGGTATAGTGGAAACTGGAAGCAACAAGTGGACTG
TAACATTTTCTTGCTGAGAAAACAAGGGACTCTTTACTGACCTGACTGATGCTGCTATTC
AATTTATTTTCCAAGTAAATCCGAAGAAGGATCATGTAAACAGCACAATGTTGGACATTG
CTTTAGTATTTCGTTCTCAGGAACATTGTTCCCTTTGCAGAGCTAGGAGCTGCAACTATG
TACTACTATCTGACATTGCTGTAACTTGTAAAACTTAATTGCATTTCAAGTATTTTCCCT
C

CDS

585 bp

>Os05t0143500-03 Similar to Kinase (Fragment).
CCAAAGATGCTGAGGGAGTTCCTTGAGGGAACTGAGTCCACTGGTTTCATGTACCCAAGT
GCAGTAGACCATTTTAAAAAACAGTTTGCATACCTTGAAGAACATTATGCCAAGGGATCA
ACAGCAGCTCCACCTGAGAGACAACATAACTCATTACCAAGGCCTTGTGTTGTCTATTCA
GATAACCGGCCACAAAGCACAGCCAGTGTCACTGAGGATCTTTCCAGGTGTTTAATCAGA
GACAACAATCTAAAATCACAGGATTCTGCTTCAGTCGGTGCAAGCAGAATCCCTCAAGGT
GCTGCTGCAAGACCTGGTAAAGCAGTTGGTTCGGTGCTGCGTTACGGTAACTGTTCGACA
TCCGCTGCTGAGCAACAATATGAGCAGCGAAGGGTTGTTCGGAACCCAGCAATTGCTCCA
AACAGCAGTGTTCCTCTGGGGAGCTCATACCCCAGAAGAAACCAGACCTGCAAGAGTGAA
ACAGGTGATGTTGAAAGGATCGATTCCAGCCAAACCGGTCCACCGAAGCCATATGTGGCG
AACAAACTGCCTGCTACCGTCGATGGTCGGAGTGGCCACTGGTAA

Protein

195 aa

>Os05t0143500-03 Similar to Kinase (Fragment).
PKMLREFLEGTESTGFMYPSAVDHFKKQFAYLEEHYAKGSTAAPPERQHNSLPRPCVVYS
DNRPQSTASVTEDLSRCLIRDNNLKSQDSASVGASRIPQGAAARPGKAVGSVLRYGNCST
SAAEQQYEQRRVVRNPAIAPNSSVPLGSSYPRRNQTCKSETGDVERIDSSQTGPPKPYVA
NKLPATVDGRSGHW*

CDS

chr05:2516325..2516383 (+ strand) : 59 bp

chr05:2516703..2516804 (+ strand) : 102 bp

chr05:2516914..2517050 (+ strand) : 137 bp

chr05:2517166..2517452 (+ strand) : 287 bp

3'UTR

chr05:2517453..2518008 (+ strand) : 556 bp

FASTA

>Os05t0143500-03 class=Sequence position=chr05:2516325..2518008 (+ strand)
CCAAAGATGC TGAGGGAGTT CCTTGAGGGA ACTGAGTCCA CTGGTTTCAT GTACCCAAGG TGTGTAGTCA TGCCAAGTTT
ATTTTTATTC CATTGCTTTA AAATCTTCAA CTGAGTTGTT CCTATTATAA TTTCTGAGAC AATTTAGTGA TCTTATTGTT
GAACTGCCAG GCCAGTTGTA TGTTGTTGAA CATGCTATAT GTCCAGGTTA ACAATTAAAT AACAAATATT TATGCGAATT
GACTGTTTTG TTGATGCACC GTATTAAGTA GTGATTACTT ATTTTAATTG CTCTATTTGT TGCTCGAAAT CGATTAGGCA
CGACAAAAAC TTGAGATAAT TCAAAGAACT AAGATCAATT ACTCTATTAT GTTTACAGTG CAGTAGACCA TTTTAAAAAA
CAGTTTGCAT ACCTTGAAGA ACATTATGCC AAGGGATCAA CAGCAGCTCC ACCTGAGAGA CAACATAACT CATTACCAAG
GTAAGATATT TATTTTATTT TATTTTATAT GACATGGATT AACCGATGGA ACTTGTAGCT CCAGTTGAAT ATATACTTGA
TTCTTGACTA TCTACTATTG TATCGACAGG CCTTGTGTTG TCTATTCAGA TAACCGGCCA CAAAGCACAG CCAGTGTCAC
TGAGGATCTT TCCAGGTGTT TAATCAGAGA CAACAATCTA AAATCACAGG ATTCTGCTTC AGTCGGTGCA AGCAGAATCC
CTCAAGGTTA GCATCTGTCC TTACCAGTTG ACTTTAACCT GCAATTAAAC TTGTATCCTC CATTATATCT TTCATACATT
GTGTGACTCA AGATAGATTT TGCACGTTAC CTATCTTCCA GGTGCTGCTG CAAGACCTGG TAAAGCAGTT GGTTCGGTGC
TGCGTTACGG TAACTGTTCG ACATCCGCTG CTGAGCAACA ATATGAGCAG CGAAGGGTTG TTCGGAACCC AGCAATTGCT
CCAAACAGCA GTGTTCCTCT GGGGAGCTCA TACCCCAGAA GAAACCAGAC CTGCAAGAGT GAAACAGGTG ATGTTGAAAG
GATCGATTCC AGCCAAACCG GTCCACCGAA GCCATATGTG GCGAACAAAC TGCCTGCTAC CGTCGATGGT CGGAGTGGCC
ACTGGTAAAT TTCTGCAGCG CACCAGCGAA AACGCTAGTT ATTACCACAG CATCAGCATG GGTTTATTGT TCTATGTAGT
AAATTCTTAG ACATTTAAAA CATGTCATTC TGTACAGACT TGTATTGTTT CTTGGGGGCT TTTCCATGAT AAAAACAGTA
GAATTGTACT GCAAGCCCTA GTGGATTAGG CTGCCTGTTT CTTCATTTCT TCATAGCTCA ACCTCTGAAT GATCTGGTAC
ACAAACAAGA TCTCATGGAA TTGGACATCA CATGATTCAG TTCGAAGGGG GTATAGTGGA AACTGGAAGC AACAAGTGGA
CTGTAACATT TTCTTGCTGA GAAAACAAGG GACTCTTTAC TGACCTGACT GATGCTGCTA TTCAATTTAT TTTCCAAGTA
AATCCGAAGA AGGATCATGT AAACAGCACA ATGTTGGACA TTGCTTTAGT ATTTCGTTCT CAGGAACATT GTTCCCTTTG
CAGAGCTAGG AGCTGCAACT ATGTACTACT ATCTGACATT GCTGTAACTT GTAAAACTTA ATTGCATTTC AAGTATTTTC
CCTC

Locus: Os05g0143500

Loading...

Locus: Os05g0143500

Loading...