Os05t0149400-01

Locus

Os05g0149400

Description

ACC oxidase, Ethylene biosynthesis

RAP-DB Gene Symbol Synonym(s)

ACO5, OsACO5

RAP-DB Gene Name Synonym(s)

AMINOCYCLOPROPANE-1-CARBOXYLIC ACID OXIDASE 5, ACC oxidase 5

CGSNL Gene Symbol

ACO5

CGSNL Gene Name

AMINOCYCLOPROPANE-1-CARBOXYLIC ACID OXIDASE 5

Oryzabase Gene Symbol Synonym(s)

OsACO5, 2-ODD14, Os2-ODD14, 2ODD14, Os2ODD14

Oryzabase Gene Name Synonym(s)

ACC oxidase 5, 2-oxoglutarate-dependent dioxygenase 14

Transcript Evidence

AK061064

Protein Evidence

Q65XE5

Literature

PMID: 17012402

Note

Manual Curation

November 27, 2009

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors (GO:0016706)

Functional domain (InterPro)

Non-haem dioxygenase N-terminal domain (IPR026992)

Isopenicillin N synthase-like (IPR027443)

Oxoglutarate/iron-dependent dioxygenase (IPR005123)

Full-length cDNA

006-206-B08 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0149400-01)

RiceXPro (AK061064)

Others

Oryzabase (9075)

KEGG (Os05t0149400-01 (EC:1.14.17.4))

Transcript

1314 bp

>Os05t0149400-01 ACC oxidase, Ethylene biosynthesis
ATCAACTGCAAGCTTACATCACACTAGCTAATTAGCTACTTACTCTTCTTCTTGCTAGCT
TGCTAGCTTCTGCATTTAGACATTGCAAAATCTGAAAAAACTTGAGAAATTAACTAAACA
AAATGGTTGTTCCGGTGATCGACTTCTCCAAGCTCGACGGCACCGCCGCAGAGAGGGCTG
AGACGATGGCGCAGATCGACAATGGCTGCGAGGAGTGGGGATTCTTCCAGCTGGTGAACC
ATGGCGTCCCGAAGGAGCTTCTTGATCGGGTGAAGAAGGTGTGCTTGGAGAGCTACCGAC
TCCGGGAGGCGGCGTTCATGGAGTCGGAGCCGGTGAGGACGCTGGAGGGGCTCATGGCGG
CGGAGCGGCGCGGCGAGGCGGCGGCGCCGGTGGACGACATGGACTGGGAGGACATCTTCT
ACCTCCACGACGACAACCAGTGGCCGTCGAACCCGCCGGAGTTCAAGGAGACGATGCGCG
AGTACCGCGCGGCGCTGCGGGGGCTCGCCGAGAGGGTGATGGAGGCCATGGACGAGAACC
TCGGCCTCGACAAGGGGCGCATGAGGCGCGCCTTCACCGGCGACGGCCGCCACGCGCCGT
TCTTCGGCACCAAGGTCAGCCACTACCCGCCGTGCCCGcgccccgacctcatcaccggcc
tccgcgcccacaccgacgccggcggcgtcatcctgctgttccaggacgaccgcgtcggcg
gcctccaggtgctcaggggcggcgagtgggtcgacgtgcagccgctcgccgacgccatcg
tcGTCAACACCGGCGACCAGGTGGAGGTGCTCAGCAACGGCCGCTACCGCAGCGCGTGGC
ACCGCGTCCTCCCCATGCGCGACGGAAACCGGCGCTCCGTCGCGTCGTTCTACAACCCGG
CGTTCGAGGCCACCATCTCGCCGGCGGTGGGCGCCGGCGGCGAGTACCCGGAGTACGTGT
TCGGCGAGTACATGGATGTGTACGCCAAGCAGAAGTTCGATGCGAAGGAGCCACGCTTCG
AGGCCGTCAAGGCGCCAAAATCTGCTTAAAGTTAAAAATAGACTTTTATTTGTGAATTAA
TTAATTGATTAGTTGCATAAACTATACATAACCGCTTTTGCTATTCAAGATAAAAAAATA
GGTGACCTTACAAAATTTAAGTGGTTATTATTGTCATGAGAATACAACTATTGTTATGTT
ACAGTATATAGTTTGGTATTTTAGTGTGTCACGGTTTGTCAGTAGGAATATATAATAATG
TAATAGATCGTGTTGTTATATATACATGAATAAACTATATAGATTTTTTTAATT

CDS

927 bp

>Os05t0149400-01 ACC oxidase, Ethylene biosynthesis
ATGGTTGTTCCGGTGATCGACTTCTCCAAGCTCGACGGCACCGCCGCAGAGAGGGCTGAG
ACGATGGCGCAGATCGACAATGGCTGCGAGGAGTGGGGATTCTTCCAGCTGGTGAACCAT
GGCGTCCCGAAGGAGCTTCTTGATCGGGTGAAGAAGGTGTGCTTGGAGAGCTACCGACTC
CGGGAGGCGGCGTTCATGGAGTCGGAGCCGGTGAGGACGCTGGAGGGGCTCATGGCGGCG
GAGCGGCGCGGCGAGGCGGCGGCGCCGGTGGACGACATGGACTGGGAGGACATCTTCTAC
CTCCACGACGACAACCAGTGGCCGTCGAACCCGCCGGAGTTCAAGGAGACGATGCGCGAG
TACCGCGCGGCGCTGCGGGGGCTCGCCGAGAGGGTGATGGAGGCCATGGACGAGAACCTC
GGCCTCGACAAGGGGCGCATGAGGCGCGCCTTCACCGGCGACGGCCGCCACGCGCCGTTC
TTCGGCACCAAGGTCAGCCACTACCCGCCGTGCCCGcgccccgacctcatcaccggcctc
cgcgcccacaccgacgccggcggcgtcatcctgctgttccaggacgaccgcgtcggcggc
ctccaggtgctcaggggcggcgagtgggtcgacgtgcagccgctcgccgacgccatcgtc
GTCAACACCGGCGACCAGGTGGAGGTGCTCAGCAACGGCCGCTACCGCAGCGCGTGGCAC
CGCGTCCTCCCCATGCGCGACGGAAACCGGCGCTCCGTCGCGTCGTTCTACAACCCGGCG
TTCGAGGCCACCATCTCGCCGGCGGTGGGCGCCGGCGGCGAGTACCCGGAGTACGTGTTC
GGCGAGTACATGGATGTGTACGCCAAGCAGAAGTTCGATGCGAAGGAGCCACGCTTCGAG
GCCGTCAAGGCGCCAAAATCTGCTTAA

Protein

309 aa

>Os05t0149400-01 ACC oxidase, Ethylene biosynthesis
MVVPVIDFSKLDGTAAERAETMAQIDNGCEEWGFFQLVNHGVPKELLDRVKKVCLESYRL
REAAFMESEPVRTLEGLMAAERRGEAAAPVDDMDWEDIFYLHDDNQWPSNPPEFKETMRE
YRAALRGLAERVMEAMDENLGLDKGRMRRAFTGDGRHAPFFGTKVSHYPPCPRPDLITGL
RAHTDAGGVILLFQDDRVGGLQVLRGGEWVDVQPLADAIVVNTGDQVEVLSNGRYRSAWH
RVLPMRDGNRRSVASFYNPAFEATISPAVGAGGEYPEYVFGEYMDVYAKQKFDAKEPRFE
AVKAPKSA*

5'UTR

chr05:2825324..2825445 (+ strand) : 122 bp

CDS

chr05:2825446..2825553 (+ strand) : 108 bp

chr05:2825829..2826647 (+ strand) : 819 bp

3'UTR

chr05:2826648..2826912 (+ strand) : 265 bp

FASTA

>Os05t0149400-01 class=Sequence position=chr05:2825324..2826912 (+ strand)
ATCAACTGCA AGCTTACATC ACACTAGCTA ATTAGCTACT TACTCTTCTT CTTGCTAGCT TGCTAGCTTC TGCATTTAGA
CATTGCAAAA TCTGAAAAAA CTTGAGAAAT TAACTAAACA AAATGGTTGT TCCGGTGATC GACTTCTCCA AGCTCGACGG
CACCGCCGCA GAGAGGGCTG AGACGATGGC GCAGATCGAC AATGGCTGCG AGGAGTGGGG ATTCTTCCAG GTAGCTATAC
ATAATCAGAT CATGTGTCTT CTTAGTTGTT GCAGAGATCG AAAGTTATAA ATCCTCAATT ATATATAAGA ATAGTTGGTG
CAGTGATCGA AAGTTATTCT CGATGAATTT AAACATATCA ACATATTGTG ACCAAAATTA TCCTTACATT TTTAAGAATA
GTTAATCAAA TGAACATGTG ATGATTGGTG ATTAGATGAT CATGACAGCA TCCATCATGT TGATTAATGA TTAAGATGGT
TAATAATCAC TTGGGATCAT TGCAGCTGGT GAACCATGGC GTCCCGAAGG AGCTTCTTGA TCGGGTGAAG AAGGTGTGCT
TGGAGAGCTA CCGACTCCGG GAGGCGGCGT TCATGGAGTC GGAGCCGGTG AGGACGCTGG AGGGGCTCAT GGCGGCGGAG
CGGCGCGGCG AGGCGGCGGC GCCGGTGGAC GACATGGACT GGGAGGACAT CTTCTACCTC CACGACGACA ACCAGTGGCC
GTCGAACCCG CCGGAGTTCA AGGAGACGAT GCGCGAGTAC CGCGCGGCGC TGCGGGGGCT CGCCGAGAGG GTGATGGAGG
CCATGGACGA GAACCTCGGC CTCGACAAGG GGCGCATGAG GCGCGCCTTC ACCGGCGACG GCCGCCACGC GCCGTTCTTC
GGCACCAAGG TCAGCCACTA CCCGCCGTGC CCGcgccccg acctcatcac cggcctccgc gcccacaccg acgccggcgg
cgtcatcctg ctgttccagg acgaccgcgt cggcggcctc caggtgctca ggggcggcga gtgggtcgac gtgcagccgc
tcgccgacgc catcgtcGTC AACACCGGCG ACCAGGTGGA GGTGCTCAGC AACGGCCGCT ACCGCAGCGC GTGGCACCGC
GTCCTCCCCA TGCGCGACGG AAACCGGCGC TCCGTCGCGT CGTTCTACAA CCCGGCGTTC GAGGCCACCA TCTCGCCGGC
GGTGGGCGCC GGCGGCGAGT ACCCGGAGTA CGTGTTCGGC GAGTACATGG ATGTGTACGC CAAGCAGAAG TTCGATGCGA
AGGAGCCACG CTTCGAGGCC GTCAAGGCGC CAAAATCTGC TTAAAGTTAA AAATAGACTT TTATTTGTGA ATTAATTAAT
TGATTAGTTG CATAAACTAT ACATAACCGC TTTTGCTATT CAAGATAAAA AAATAGGTGA CCTTACAAAA TTTAAGTGGT
TATTATTGTC ATGAGAATAC AACTATTGTT ATGTTACAGT ATATAGTTTG GTATTTTAGT GTGTCACGGT TTGTCAGTAG
GAATATATAA TAATGTAATA GATCGTGTTG TTATATATAC ATGAATAAAC TATATAGATT TTTTTAATT

Locus: Os05g0149400

Loading...

Locus: Os05g0149400

Loading...