Os05t0153066-00

Locus

Os05g0153066

Description

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

UBC36

CGSNL Gene Name

UBIQUITIN-CONJUGATING ENZYME 36

Oryzabase Gene Symbol Synonym(s)

OsUBC36

Oryzabase Gene Name Synonym(s)

Ubiquitin-conjugating enzyme 36

Transcript Evidence

Protein Evidence

Literature

Note

Manual Curation

Expression Databases

TENOR (Os05t0153066-00)

Others

Oryzabase (19570)

Transcript

1827 bp

>Os05t0153066-00
ATGAACGGCGCGTTCTACCCAGGCCAGCGCGTCACCGGCCACCACGTCCTGGCGTCGCCG
TCGATCGCCTTCAAGGACGCGCGGTGGCTGAGGGGGTACTGGAAGCTCACCCGCCTCGAG
GGCACCGTCGCCAAGGTCGCCATGACCGGCGTCCTCGTCTACTGGATCGCCTCGGCGCAG
CTCGGCACCAGCAAGAGCCTCATCAACGCGTCCTCGCCGCCGGCGTTCCAGGACCCCGGC
GATCTCACCCTCTTCTGCTCCGACGACGAGTGCCCCTGGGCGTTCGGCGATCGCTGCTTC
ATCGCCACCCCTCCCCGCCACCGCCGCCGCCGCCGCCAGCCGCGTGTTCCCACTGATGAT
GACAAACAGGAAGCGTCGCCGGCGGCGGCGACGACGAACCAAGATGCCGCGGCGGCCGCG
CCGCCGGTGGAGAAGAAGGAGAACACGTACAGGAACCAGCTGAGGAAGTTCTTCTACAAG
AGGGACTTGAGGGCGACGCGGTGGGGCGCCAGGGCGCGCGCCGTGGACAAGGTGATGCTC
GTCTCCGGCACCCGCACCACCGCCGACGTGCTGTGGCAGGACGGCACGCTGCGGCGCGGC
GTGCCGTCGCTGGAGCTGGTGCCGTTCGACATCCTCAACGACCACGAGTTCTTCCCGGGC
CAGCACGTCGTCGTCGACACCATGgcggcggcggaagcaacgacggcggcggcgaggcgc
gtcggcgtcgtcaggagagtcgaccccaaggaccagacggtgcgcgtgtcgtggctcgat
ggcggcgacggcggcggcgaggagaccgtggcgagcgcgTACGATCTCCGCAAGTACTCC
CGCCACGACGTGTTCTACGGAGACGTCGTCGTCCGGCTGCTCCCGCCGCCGCCGGAATCA
GCCGACGCCGCCGGCGAGGGAGCAGCACCACCGGCACAGGGCACCAAAGCCGCCGCCGCC
GACCTTTCATGGGTCGGGCGTGTCGTCGACGTCCGCGACGGCCACGTCCAAGTCCGGTGG
GGCAACGGCGAGACATCAACGGCGGTGCACAGCGAGGTACGCGGCGTCGACATGCGGAGC
TTCTGGGCGCTGGAGCACGAGGTCGGGCCATGGCTGGCGGAGGGACGCGACCGCGCGGCC
GCAGCACTAGCGCAACCTCCTCCTCCACCTCCACCACCACCACCACCACCTGCCGCCGGT
AACAATAACAACAATGTCGCCAACGCCGGAGCCGCCGGGAACACTGCCGGACCTGCCGCC
GCCGCCCCTGCACCATCGCCGACGTTGATCGTCCGTGTCAGCGCTGCCGTCCGGAAGGTG
TTCGACGCGGCGTCCCAGCTCGTGGCCCTAGGTAAGAGCTACCTGGTAACCGTCTCATCG
TCGTCGTCAATCTCGGCGGCGGCGGCCACGGCCACGGGCAACGCCGAAGCGCCGCCGCCG
GCTGGACCCACCGCCGGTGGCGATGTCAACGTCGAGCCTGCTCCTGCTGTTCCTGCTGCT
GTTGCTGTCAATGGCGTCGCCGGCGAGGACGCAGCTGCTCCTGCTCCGGATGCTGCTGCT
CTGCCAAGCAGCAGCGACGCAGGTGGCGGCGACGGCGACGGTGACGGCGATGGCGGTGAC
TCCGCCAGCGACGGCGGATGGAAGGAGAAGGTGGAGGATGATTCGCTCGGCGTCGCGCAC
TTCGACGTCGTGCAGTGCCCGCCTGATCACCATTTCCTGGATTGCAAGCTAGAGGGTGCT
GCTCATGGAAACAAATGGGTAAAGAGAGTCCAAAAAGAATGGCAGATATTGGGCAACGAT
AACTTACCAGGTACACTTTCTAGTTGA

CDS

1827 bp

>Os05t0153066-00
ATGAACGGCGCGTTCTACCCAGGCCAGCGCGTCACCGGCCACCACGTCCTGGCGTCGCCG
TCGATCGCCTTCAAGGACGCGCGGTGGCTGAGGGGGTACTGGAAGCTCACCCGCCTCGAG
GGCACCGTCGCCAAGGTCGCCATGACCGGCGTCCTCGTCTACTGGATCGCCTCGGCGCAG
CTCGGCACCAGCAAGAGCCTCATCAACGCGTCCTCGCCGCCGGCGTTCCAGGACCCCGGC
GATCTCACCCTCTTCTGCTCCGACGACGAGTGCCCCTGGGCGTTCGGCGATCGCTGCTTC
ATCGCCACCCCTCCCCGCCACCGCCGCCGCCGCCGCCAGCCGCGTGTTCCCACTGATGAT
GACAAACAGGAAGCGTCGCCGGCGGCGGCGACGACGAACCAAGATGCCGCGGCGGCCGCG
CCGCCGGTGGAGAAGAAGGAGAACACGTACAGGAACCAGCTGAGGAAGTTCTTCTACAAG
AGGGACTTGAGGGCGACGCGGTGGGGCGCCAGGGCGCGCGCCGTGGACAAGGTGATGCTC
GTCTCCGGCACCCGCACCACCGCCGACGTGCTGTGGCAGGACGGCACGCTGCGGCGCGGC
GTGCCGTCGCTGGAGCTGGTGCCGTTCGACATCCTCAACGACCACGAGTTCTTCCCGGGC
CAGCACGTCGTCGTCGACACCATGgcggcggcggaagcaacgacggcggcggcgaggcgc
gtcggcgtcgtcaggagagtcgaccccaaggaccagacggtgcgcgtgtcgtggctcgat
ggcggcgacggcggcggcgaggagaccgtggcgagcgcgTACGATCTCCGCAAGTACTCC
CGCCACGACGTGTTCTACGGAGACGTCGTCGTCCGGCTGCTCCCGCCGCCGCCGGAATCA
GCCGACGCCGCCGGCGAGGGAGCAGCACCACCGGCACAGGGCACCAAAGCCGCCGCCGCC
GACCTTTCATGGGTCGGGCGTGTCGTCGACGTCCGCGACGGCCACGTCCAAGTCCGGTGG
GGCAACGGCGAGACATCAACGGCGGTGCACAGCGAGGTACGCGGCGTCGACATGCGGAGC
TTCTGGGCGCTGGAGCACGAGGTCGGGCCATGGCTGGCGGAGGGACGCGACCGCGCGGCC
GCAGCACTAGCGCAACCTCCTCCTCCACCTCCACCACCACCACCACCACCTGCCGCCGGT
AACAATAACAACAATGTCGCCAACGCCGGAGCCGCCGGGAACACTGCCGGACCTGCCGCC
GCCGCCCCTGCACCATCGCCGACGTTGATCGTCCGTGTCAGCGCTGCCGTCCGGAAGGTG
TTCGACGCGGCGTCCCAGCTCGTGGCCCTAGGTAAGAGCTACCTGGTAACCGTCTCATCG
TCGTCGTCAATCTCGGCGGCGGCGGCCACGGCCACGGGCAACGCCGAAGCGCCGCCGCCG
GCTGGACCCACCGCCGGTGGCGATGTCAACGTCGAGCCTGCTCCTGCTGTTCCTGCTGCT
GTTGCTGTCAATGGCGTCGCCGGCGAGGACGCAGCTGCTCCTGCTCCGGATGCTGCTGCT
CTGCCAAGCAGCAGCGACGCAGGTGGCGGCGACGGCGACGGTGACGGCGATGGCGGTGAC
TCCGCCAGCGACGGCGGATGGAAGGAGAAGGTGGAGGATGATTCGCTCGGCGTCGCGCAC
TTCGACGTCGTGCAGTGCCCGCCTGATCACCATTTCCTGGATTGCAAGCTAGAGGGTGCT
GCTCATGGAAACAAATGGGTAAAGAGAGTCCAAAAAGAATGGCAGATATTGGGCAACGAT
AACTTACCAGGTACACTTTCTAGTTGA

Protein

609 aa

>Os05t0153066-00
MNGAFYPGQRVTGHHVLASPSIAFKDARWLRGYWKLTRLEGTVAKVAMTGVLVYWIASAQ
LGTSKSLINASSPPAFQDPGDLTLFCSDDECPWAFGDRCFIATPPRHRRRRRQPRVPTDD
DKQEASPAAATTNQDAAAAAPPVEKKENTYRNQLRKFFYKRDLRATRWGARARAVDKVML
VSGTRTTADVLWQDGTLRRGVPSLELVPFDILNDHEFFPGQHVVVDTMAAAEATTAAARR
VGVVRRVDPKDQTVRVSWLDGGDGGGEETVASAYDLRKYSRHDVFYGDVVVRLLPPPPES
ADAAGEGAAPPAQGTKAAAADLSWVGRVVDVRDGHVQVRWGNGETSTAVHSEVRGVDMRS
FWALEHEVGPWLAEGRDRAAAALAQPPPPPPPPPPPPAAGNNNNNVANAGAAGNTAGPAA
AAPAPSPTLIVRVSAAVRKVFDAASQLVALGKSYLVTVSSSSSISAAAATATGNAEAPPP
AGPTAGGDVNVEPAPAVPAAVAVNGVAGEDAAAPAPDAAALPSSSDAGGGDGDGDGDGGD
SASDGGWKEKVEDDSLGVAHFDVVQCPPDHHFLDCKLEGAAHGNKWVKRVQKEWQILGND
NLPGTLSS*

CDS

chr05:3058440..3060173 (+ strand) : 1734 bp

chr05:3060356..3060448 (+ strand) : 93 bp

FASTA

>Os05t0153066-00 class=Sequence position=chr05:3058440..3060448 (+ strand)
ATGAACGGCG CGTTCTACCC AGGCCAGCGC GTCACCGGCC ACCACGTCCT GGCGTCGCCG TCGATCGCCT TCAAGGACGC
GCGGTGGCTG AGGGGGTACT GGAAGCTCAC CCGCCTCGAG GGCACCGTCG CCAAGGTCGC CATGACCGGC GTCCTCGTCT
ACTGGATCGC CTCGGCGCAG CTCGGCACCA GCAAGAGCCT CATCAACGCG TCCTCGCCGC CGGCGTTCCA GGACCCCGGC
GATCTCACCC TCTTCTGCTC CGACGACGAG TGCCCCTGGG CGTTCGGCGA TCGCTGCTTC ATCGCCACCC CTCCCCGCCA
CCGCCGCCGC CGCCGCCAGC CGCGTGTTCC CACTGATGAT GACAAACAGG AAGCGTCGCC GGCGGCGGCG ACGACGAACC
AAGATGCCGC GGCGGCCGCG CCGCCGGTGG AGAAGAAGGA GAACACGTAC AGGAACCAGC TGAGGAAGTT CTTCTACAAG
AGGGACTTGA GGGCGACGCG GTGGGGCGCC AGGGCGCGCG CCGTGGACAA GGTGATGCTC GTCTCCGGCA CCCGCACCAC
CGCCGACGTG CTGTGGCAGG ACGGCACGCT GCGGCGCGGC GTGCCGTCGC TGGAGCTGGT GCCGTTCGAC ATCCTCAACG
ACCACGAGTT CTTCCCGGGC CAGCACGTCG TCGTCGACAC CATGgcggcg gcggaagcaa cgacggcggc ggcgaggcgc
gtcggcgtcg tcaggagagt cgaccccaag gaccagacgg tgcgcgtgtc gtggctcgat ggcggcgacg gcggcggcga
ggagaccgtg gcgagcgcgT ACGATCTCCG CAAGTACTCC CGCCACGACG TGTTCTACGG AGACGTCGTC GTCCGGCTGC
TCCCGCCGCC GCCGGAATCA GCCGACGCCG CCGGCGAGGG AGCAGCACCA CCGGCACAGG GCACCAAAGC CGCCGCCGCC
GACCTTTCAT GGGTCGGGCG TGTCGTCGAC GTCCGCGACG GCCACGTCCA AGTCCGGTGG GGCAACGGCG AGACATCAAC
GGCGGTGCAC AGCGAGGTAC GCGGCGTCGA CATGCGGAGC TTCTGGGCGC TGGAGCACGA GGTCGGGCCA TGGCTGGCGG
AGGGACGCGA CCGCGCGGCC GCAGCACTAG CGCAACCTCC TCCTCCACCT CCACCACCAC CACCACCACC TGCCGCCGGT
AACAATAACA ACAATGTCGC CAACGCCGGA GCCGCCGGGA ACACTGCCGG ACCTGCCGCC GCCGCCCCTG CACCATCGCC
GACGTTGATC GTCCGTGTCA GCGCTGCCGT CCGGAAGGTG TTCGACGCGG CGTCCCAGCT CGTGGCCCTA GGTAAGAGCT
ACCTGGTAAC CGTCTCATCG TCGTCGTCAA TCTCGGCGGC GGCGGCCACG GCCACGGGCA ACGCCGAAGC GCCGCCGCCG
GCTGGACCCA CCGCCGGTGG CGATGTCAAC GTCGAGCCTG CTCCTGCTGT TCCTGCTGCT GTTGCTGTCA ATGGCGTCGC
CGGCGAGGAC GCAGCTGCTC CTGCTCCGGA TGCTGCTGCT CTGCCAAGCA GCAGCGACGC AGGTGGCGGC GACGGCGACG
GTGACGGCGA TGGCGGTGAC TCCGCCAGCG ACGGCGGATG GAAGGAGAAG GTGGAGGATG ATTCGCTCGG CGTCGCGCAC
TTCGACGTCG TGCAGTGCCC GCCTGATCAC CATTTCCTGG ATTGCAAGCT AGAGGTAATT AATTCTTGTA CTAATTCTTT
GGATTACATT TTTTTTATTG AAGTGATCTC TCTTTTTTTT TTTGGCTATT TGTAAGTGTC AGCCACACAG TATGTTTTAC
TGTTTTGTTT TAATTTTATT TTGTTTTGGT GTAAATTTAT ATTTGGTTTG ATTTGGACGT TGCACATGAA AAACAGGGTG
CTGCTCATGG AAACAAATGG GTAAAGAGAG TCCAAAAAGA ATGGCAGATA TTGGGCAACG ATAACTTACC AGGTACACTT
TCTAGTTGA

Locus: Os05g0153066

Loading...

Locus: Os05g0153066

Loading...