Os05t0153132-00

Locus

Os05g0153132

Description

Similar to UBC23 (UBIQUITIN-CONJUGATING ENZYME 23); small conjugating protein ligase/ ubiquitin-protein ligase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

UBC36

CGSNL Gene Name

UBIQUITIN-CONJUGATING ENZYME 36

Oryzabase Gene Symbol Synonym(s)

OsUBC36

Oryzabase Gene Name Synonym(s)

Ubiquitin-conjugating enzyme 36

Transcript Evidence

BT087279 (DDBJ)

Protein Evidence

NP_179284.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: acid-amino acid ligase activity (GO:0016881)

Functional domain (InterPro)

Ubiquitin-conjugating enzyme, E2 (IPR000608)

Ubiquitin-conjugating enzyme/RWD-like (IPR016135)

Expression Databases

TENOR (Os05t0153132-00)

Others

Oryzabase (19570)

Transcript

789 bp

>Os05t0153132-00 Similar to UBC23 (UBIQUITIN-CONJUGATING ENZYME 23); small conjugating protein ligase/ ubiquitin-protein ligase.
GATCATAAACCGTGCACTCGTGTACATTTATGCAATGCAGGGACTATATATGTGCGCGCG
TTCGAAGACCGGATGGACTTGCTCCGGGCAGCGATGGTGGGCGCCGCCGGCTCGCCGTAC
CACGACGGCCTCTTCCTCTTCGACCTCCACCTCCCGGCGACCTACCCGGCGGCGCCGCCG
GAGGTGTACTACCACTCGTTCGGCCTCCGCGTGAACCCCAACCTCTACCCCTCGGGCACC
GTCTGCCTCAGCCTCCTCAACACGTTCGACGGCGAGGGCGTCGAGGTGTGGTCGCCGGCG
AGGTCGACGCTGCTCCAGGTGCTCGTCTCCATCCAGGGCCTCGTCCTCACCGCCGACCCC
TACTACAACGAGGCCGGCTACGACGCCTACGCCGGCACGCCGGGGGGCCGCCGGAACGCC
GCCTCCTACGCCGAGAACGCCTGCCTGCTCACGCTCCGGAGCGCGCTCCACCTCCTCCGC
CGCCCGCCGCGGGGCTTCGAGGGCGTCGTCGGGGCACACTTCCGCCGCCGCGGCGCCCAC
GTGCTCGCCGCCTGCGAGTCGTACCTGCGGGGAACGCGCGTCGCCGGAGACGGGGGAGAC
GGCGGCGGCGGCGAGAGGACGTGCTCGGCGGGGTTCAGGCTCGCGCTGCGCAACGTCGTG
CCGGTGCTCGCGGCGGCGTTCGCGGAGATCGGCGTCGAGGGGTGTGAGCGGTTCGGCGAC
GGCGAGCTCGGACAGTGCTCTCTCACCGCCATTGATGACAGCGCTGCTAGCGCTGATGCT
TCAGATTAA

CDS

789 bp

>Os05t0153132-00 Similar to UBC23 (UBIQUITIN-CONJUGATING ENZYME 23); small conjugating protein ligase/ ubiquitin-protein ligase.
GATCATAAACCGTGCACTCGTGTACATTTATGCAATGCAGGGACTATATATGTGCGCGCG
TTCGAAGACCGGATGGACTTGCTCCGGGCAGCGATGGTGGGCGCCGCCGGCTCGCCGTAC
CACGACGGCCTCTTCCTCTTCGACCTCCACCTCCCGGCGACCTACCCGGCGGCGCCGCCG
GAGGTGTACTACCACTCGTTCGGCCTCCGCGTGAACCCCAACCTCTACCCCTCGGGCACC
GTCTGCCTCAGCCTCCTCAACACGTTCGACGGCGAGGGCGTCGAGGTGTGGTCGCCGGCG
AGGTCGACGCTGCTCCAGGTGCTCGTCTCCATCCAGGGCCTCGTCCTCACCGCCGACCCC
TACTACAACGAGGCCGGCTACGACGCCTACGCCGGCACGCCGGGGGGCCGCCGGAACGCC
GCCTCCTACGCCGAGAACGCCTGCCTGCTCACGCTCCGGAGCGCGCTCCACCTCCTCCGC
CGCCCGCCGCGGGGCTTCGAGGGCGTCGTCGGGGCACACTTCCGCCGCCGCGGCGCCCAC
GTGCTCGCCGCCTGCGAGTCGTACCTGCGGGGAACGCGCGTCGCCGGAGACGGGGGAGAC
GGCGGCGGCGGCGAGAGGACGTGCTCGGCGGGGTTCAGGCTCGCGCTGCGCAACGTCGTG
CCGGTGCTCGCGGCGGCGTTCGCGGAGATCGGCGTCGAGGGGTGTGAGCGGTTCGGCGAC
GGCGAGCTCGGACAGTGCTCTCTCACCGCCATTGATGACAGCGCTGCTAGCGCTGATGCT
TCAGATTAA

Protein

263 aa

>Os05t0153132-00 Similar to UBC23 (UBIQUITIN-CONJUGATING ENZYME 23); small conjugating protein ligase/ ubiquitin-protein ligase.
DHKPCTRVHLCNAGTIYVRAFEDRMDLLRAAMVGAAGSPYHDGLFLFDLHLPATYPAAPP
EVYYHSFGLRVNPNLYPSGTVCLSLLNTFDGEGVEVWSPARSTLLQVLVSIQGLVLTADP
YYNEAGYDAYAGTPGGRRNAASYAENACLLTLRSALHLLRRPPRGFEGVVGAHFRRRGAH
VLAACESYLRGTRVAGDGGDGGGGERTCSAGFRLALRNVVPVLAAAFAEIGVEGCERFGD
GELGQCSLTAIDDSAASADASD*

CDS

chr05:3061080..3061868 (+ strand) : 789 bp

FASTA

>Os05t0153132-00 class=Sequence position=chr05:3061080..3061868 (+ strand)
GATCATAAAC CGTGCACTCG TGTACATTTA TGCAATGCAG GGACTATATA TGTGCGCGCG TTCGAAGACC GGATGGACTT
GCTCCGGGCA GCGATGGTGG GCGCCGCCGG CTCGCCGTAC CACGACGGCC TCTTCCTCTT CGACCTCCAC CTCCCGGCGA
CCTACCCGGC GGCGCCGCCG GAGGTGTACT ACCACTCGTT CGGCCTCCGC GTGAACCCCA ACCTCTACCC CTCGGGCACC
GTCTGCCTCA GCCTCCTCAA CACGTTCGAC GGCGAGGGCG TCGAGGTGTG GTCGCCGGCG AGGTCGACGC TGCTCCAGGT
GCTCGTCTCC ATCCAGGGCC TCGTCCTCAC CGCCGACCCC TACTACAACG AGGCCGGCTA CGACGCCTAC GCCGGCACGC
CGGGGGGCCG CCGGAACGCC GCCTCCTACG CCGAGAACGC CTGCCTGCTC ACGCTCCGGA GCGCGCTCCA CCTCCTCCGC
CGCCCGCCGC GGGGCTTCGA GGGCGTCGTC GGGGCACACT TCCGCCGCCG CGGCGCCCAC GTGCTCGCCG CCTGCGAGTC
GTACCTGCGG GGAACGCGCG TCGCCGGAGA CGGGGGAGAC GGCGGCGGCG GCGAGAGGAC GTGCTCGGCG GGGTTCAGGC
TCGCGCTGCG CAACGTCGTG CCGGTGCTCG CGGCGGCGTT CGCGGAGATC GGCGTCGAGG GGTGTGAGCG GTTCGGCGAC
GGCGAGCTCG GACAGTGCTC TCTCACCGCC ATTGATGACA GCGCTGCTAG CGCTGATGCT TCAGATTAA

Locus: Os05g0153132

Loading...

Locus: Os05g0153132

Loading...