Os05t0154600-01

Locus

Os05g0154600

Description

RING E3 ubiquitin ligase, Target of the M. oryzae effector AvrPiz-t, Component of pathogen-associated molecular pattern-triggered immunity

RAP-DB Gene Symbol Synonym(s)

APIP6

RAP-DB Gene Name Synonym(s)

AvrPiz-t Interacting Protein 6

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

APIP6

Oryzabase Gene Name Synonym(s)

AvrPiz-t Interacting Protein 6

Transcript Evidence

AK111816 (truncated)

Inferred from literature

Protein Evidence

Q0DKM6

Literature

PMID: 23204406

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

August 4, 2020

Functional domain (InterPro)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Zinc finger, RING-type (IPR001841)

Full-length cDNA

J013147K05(truncated) (Online Clone Ordering)

Expression Databases

TENOR (Os05t0154600-01)

RiceXPro (AK111816)

Others

Oryzabase (11676)

KEGG (Os05t0154600-01)

Transcript

1752 bp

>Os05t0154600-01 RING E3 ubiquitin ligase, Target of the M. oryzae effector AvrPiz-t, Component of pathogen-associated molecular pattern-triggered immunity
GTGGAGGCGAGCAGATAGACCAAGAGAGAGAAAGGAAGGGGAGCGACGAGGAGGAGGAGG
AGGAGGACGCCGTGGGCGCGCGCGATCGATCCCCGAGAGCGCGGCAGATTCCGGCCGCCA
GCGCGCCGTCCCCGGGGCGGCCGTCTCCGGTGCCGATTTGGTGGGATCCGGGCCGGAGAA
GCACTGGTTGGTGAGGAGGGTGAGGGGGGATGGGTGCGAGGGAGGAGGTGAGGGAGGAGG
AGGGGGAGGAGGGGGAGGGGGTGGGCGGGAAGGAGGAGGAGAAGGCGGCGGCCGCGGCCG
CGGCGGTGTCGTGCTCGATCTGCCTCGACGCGGTTGTCGCCGCCGGCGGGGAGAGGTCCA
CGGCGAGGCTGCAGTGTGGCCACGAGTTCCACCTCGATTGCATTGGATCAGCATTTAATG
CCAAAGGCGTTATGCAATGCCCCAACTGCCGCAAAATTGAAAAGGGGAACTGGCTCTATG
CAAATGGTTCCCGACCCACACAAGATGTTAATATGGATGAGTGGGCTCATGATGAAGACC
TTTATGATGTTAGTTACTCGGAGATGCCCTTTCGGTTTCACTGGTGCCCATTTGGTCGTT
TGGCTCAACTTCCATCCTTCTTTGAGGAAGGAGAATCATCACCCCCAGTTACTTTTCATG
ACTTCATGGGACAACATATGTTTACGGAGCATGTAGCTGCTGTATCTTCTGCACCTGGGG
CAGCTCATCCATGCCCATATGTGGCATACTTGCATCCTCTTCCATCATTGGCGTCATCAT
CAAGCTCTCATGTTCCTGAGAGAACTATGGATGGTCCTGCATATCATGATCCCTGGCACC
CCTTGGCTGGGCCTTCAGATGGTAGGCCCTTGCAATCAGTGCAACCTGCTGATTTTCATC
ATAACCATTGGGCGCATGTTCCCAATTCCTATCCTCAACCCAACAACAATAATGGGGTGG
CCGAGCAGCAAGGAGTCCCTTTTGGAACAACGAGGGCTGCAAGAGTTGATGGTGATACCC
AACGTCGAGGATCATCTATTTCTCCATCATACTTCAGTAATGGATCTGGTTCTAGATCTA
GAGCTCCTAATGTTCCTCCTATGGTACCTCAATTCATGAGGGCGCACGGCAGCATTAGTG
AACAGTACCAGCAGAGTTCATCATCCAGCTTATTTGCTGGGGCTCATAGATCAGGAGGCA
TGCGAACTGCACCGCCGCCCCCTCTACCAGAGAACCCGGCATTTTGCCTTTTCCCACCAG
GTTCATCTGGCCATAACTCGATGGAGACTGATGATGCAGGAGGAAACCGATTCTATGCCT
GGGAACGGGATCGCTTCGCACCATACCCACTAATGCCAGTGGACTGTGAGACAAACTGGT
GGAGTTCACAACAATCTCATGGTACATCAGAACCCGCGCCTGCTCCAAGGAGACTATTTG
GGCAATGGATTGGTGTTGGAAGATCATCTCCGGAAAATCGATCACCCGAGGGCTCATCGT
ATCGGCAAATGCACACCCCAAGGATGTAGACCCTCATGAAGGGAATTTAAGTTAATACTT
AACATTTGAAATCTGAAGTTGCTTGTAAGAAGATGGAAAACCCATTGTATGAAATTAAGC
CCGGGTCGTGCCGTAAGCCTCGAAGCAAATCTGAGAAGAAGAAACAGAAAATAACCCGGG
GTGGACATTTTGATTTGGTTTATTGAGTTCCATCACGTACATATTTGAAATCAAGTTGGG
ATATTCGGAGTT

CDS

1320 bp

>Os05t0154600-01 RING E3 ubiquitin ligase, Target of the M. oryzae effector AvrPiz-t, Component of pathogen-associated molecular pattern-triggered immunity
ATGGGTGCGAGGGAGGAGGTGAGGGAGGAGGAGGGGGAGGAGGGGGAGGGGGTGGGCGGG
AAGGAGGAGGAGAAGGCGGCGGCCGCGGCCGCGGCGGTGTCGTGCTCGATCTGCCTCGAC
GCGGTTGTCGCCGCCGGCGGGGAGAGGTCCACGGCGAGGCTGCAGTGTGGCCACGAGTTC
CACCTCGATTGCATTGGATCAGCATTTAATGCCAAAGGCGTTATGCAATGCCCCAACTGC
CGCAAAATTGAAAAGGGGAACTGGCTCTATGCAAATGGTTCCCGACCCACACAAGATGTT
AATATGGATGAGTGGGCTCATGATGAAGACCTTTATGATGTTAGTTACTCGGAGATGCCC
TTTCGGTTTCACTGGTGCCCATTTGGTCGTTTGGCTCAACTTCCATCCTTCTTTGAGGAA
GGAGAATCATCACCCCCAGTTACTTTTCATGACTTCATGGGACAACATATGTTTACGGAG
CATGTAGCTGCTGTATCTTCTGCACCTGGGGCAGCTCATCCATGCCCATATGTGGCATAC
TTGCATCCTCTTCCATCATTGGCGTCATCATCAAGCTCTCATGTTCCTGAGAGAACTATG
GATGGTCCTGCATATCATGATCCCTGGCACCCCTTGGCTGGGCCTTCAGATGGTAGGCCC
TTGCAATCAGTGCAACCTGCTGATTTTCATCATAACCATTGGGCGCATGTTCCCAATTCC
TATCCTCAACCCAACAACAATAATGGGGTGGCCGAGCAGCAAGGAGTCCCTTTTGGAACA
ACGAGGGCTGCAAGAGTTGATGGTGATACCCAACGTCGAGGATCATCTATTTCTCCATCA
TACTTCAGTAATGGATCTGGTTCTAGATCTAGAGCTCCTAATGTTCCTCCTATGGTACCT
CAATTCATGAGGGCGCACGGCAGCATTAGTGAACAGTACCAGCAGAGTTCATCATCCAGC
TTATTTGCTGGGGCTCATAGATCAGGAGGCATGCGAACTGCACCGCCGCCCCCTCTACCA
GAGAACCCGGCATTTTGCCTTTTCCCACCAGGTTCATCTGGCCATAACTCGATGGAGACT
GATGATGCAGGAGGAAACCGATTCTATGCCTGGGAACGGGATCGCTTCGCACCATACCCA
CTAATGCCAGTGGACTGTGAGACAAACTGGTGGAGTTCACAACAATCTCATGGTACATCA
GAACCCGCGCCTGCTCCAAGGAGACTATTTGGGCAATGGATTGGTGTTGGAAGATCATCT
CCGGAAAATCGATCACCCGAGGGCTCATCGTATCGGCAAATGCACACCCCAAGGATGTAG

Protein

440 aa

>Os05t0154600-01 RING E3 ubiquitin ligase, Target of the M. oryzae effector AvrPiz-t, Component of pathogen-associated molecular pattern-triggered immunity
MGAREEVREEEGEEGEGVGGKEEEKAAAAAAAVSCSICLDAVVAAGGERSTARLQCGHEF
HLDCIGSAFNAKGVMQCPNCRKIEKGNWLYANGSRPTQDVNMDEWAHDEDLYDVSYSEMP
FRFHWCPFGRLAQLPSFFEEGESSPPVTFHDFMGQHMFTEHVAAVSSAPGAAHPCPYVAY
LHPLPSLASSSSSHVPERTMDGPAYHDPWHPLAGPSDGRPLQSVQPADFHHNHWAHVPNS
YPQPNNNNGVAEQQGVPFGTTRAARVDGDTQRRGSSISPSYFSNGSGSRSRAPNVPPMVP
QFMRAHGSISEQYQQSSSSSLFAGAHRSGGMRTAPPPPLPENPAFCLFPPGSSGHNSMET
DDAGGNRFYAWERDRFAPYPLMPVDCETNWWSSQQSHGTSEPAPAPRRLFGQWIGVGRSS
PENRSPEGSSYRQMHTPRM*

5'UTR

chr05:3195563..3195771 (- strand) : 209 bp

CDS

chr05:3195376..3195562 (- strand) : 187 bp

chr05:3193532..3193701 (- strand) : 170 bp

chr05:3192611..3192669 (- strand) : 59 bp

chr05:3191542..3191570 (- strand) : 29 bp

chr05:3191051..3191459 (- strand) : 409 bp

chr05:3190075..3190540 (- strand) : 466 bp

3'UTR

chr05:3189852..3190074 (- strand) : 223 bp

FASTA

>Os05t0154600-01 class=Sequence position=chr05:3189852..3195771 (- strand)
GTGGAGGCGA GCAGATAGAC CAAGAGAGAG AAAGGAAGGG GAGCGACGAG GAGGAGGAGG AGGAGGACGC CGTGGGCGCG
CGCGATCGAT CCCCGAGAGC GCGGCAGATT CCGGCCGCCA GCGCGCCGTC CCCGGGGCGG CCGTCTCCGG TGCCGATTTG
GTGGGATCCG GGCCGGAGAA GCACTGGTTG GTGAGGAGGG TGAGGGGGGA TGGGTGCGAG GGAGGAGGTG AGGGAGGAGG
AGGGGGAGGA GGGGGAGGGG GTGGGCGGGA AGGAGGAGGA GAAGGCGGCG GCCGCGGCCG CGGCGGTGTC GTGCTCGATC
TGCCTCGACG CGGTTGTCGC CGCCGGCGGG GAGAGGTCCA CGGCGAGGCT GCAGTGTGGC CACGAGTTCC ACCTCGGTAT
GTATGTGGCT TTCGGATGAT CTACAGATGT GTTATTGGTA GGGAATTGTA AGTTAGAGCA CTAGAACTGC GATTTTTTTT
GGACTCGCGC TGTCAATTTG ATTTGGGTGA GGGTAGCTGT AAAATGTGAT GCTTTTGTTA GGAATTGGGG CTGGACTTGG
TGGGAATTAA GATAATTTTA CGTCTTCTAG CTGTAATGGT GCAGAATTTT GGGCGATGGT TCGCATAGGT AGTGAGTGCC
TTTTGGGGGT AACCATCAAT GTTTTCCCCA GTGGGTGGGT GGGTTGGGGG ATGAAAGGAA GATTTCGTGC TAAAATTGCT
GGTATATAGG GTGAAATAGT CTGGCTGACA TGCATCACAA ATTTCCGGTA CTGGCCTGGT CCGATGACTC GTAGAGTTTG
CGGATTTGAT CAGATACTAT GAAAGAACAT CAGAATAGCT TGAGCGGAGT TTCTTGATGG GTTCTTAGTT CAATGGAAGT
TATGAAACAA AGCATCGGAC CAAATAATTA TTTTAGCCAG ACAAGGAAAT CAAGTAAATC ACATCAGTTG GAAATTGATA
CTAACATGGA AACCAATGGA AGCAAACAGA TAGAGCAAAT ATTGATCTTG AGATTGCGCT TCTCTATACC ATGGTAGAGG
CAGGTTGGCA TGTTGAGCAG ATAATAAATT GGCCCCTTAA TACAACGATG GACCTATGCA CCCACTGGTA ACCTTTAAAC
AGGGCTGGCT TAGTGGACCA ATGGTTTGAC CCACCCATTT GGACCCCTGG ATGAAAGTCT GTTTGGTTCC CAGGAATTTT
TGGGGGTTAT TGAGCTAGCT GTTCAATTTT AGTGAATGGT TGCACTTTGA AGGCTTGTCT GGAGGATTTA AAAATGTCCC
ATGGCATGCT TAGACCTAAA CTTATAGGAA ACTAAGGACG ACACAGATTT GAATAGTTCA GTTTGATGGT TTCATTGAGC
GTTGAGCCAT AGTGACACTG ACATACTGTA GTAGATAGGG TTTCCCTCTC TCCTTTTTAT GCTGTACAAG GAATTAGGTG
CAATCCTGAG AATATGTAGT TAACTGCAAT CCTTGTTTCC TACTTTCCTG GAAATTACTC TTAGGTAATA TTTTTTGTTG
GAAGTCAGAA CCATGTTTAC ATTCTATATA TACTTGGTTC ATGTTCTTTT ACTGGTATCA AGTTTTATCT GGTCTGTTGT
TATTTGGTAA CAAGTTATCT TGATGGGATT GAGTTTTTGT CTTATAAGCT GTCAGCCGTG ACGCATGAGC AAGgcaacag
aaaaataatt ttagtgcaga cttctatact tctactctta gtggttaaaa gcctaaggct gaaaaataga gaaggatgga
aaaacatcta aactaattca aaattaagtt tcaaaactca aatttggccg cagcttataa gcTGCCGAGC TGCCAACAAG
TTAGTATCAA ATATGGACTG TCTTTTAGTT ATCAAAATCC TTTAGATTTT CTAAGTTAAC AAGCCTCAAT GATCTTGGAT
TCACTTATTA ACCACCATTG TTTTTTGTGC ATTAGCAATG ATTTTATTTG CTTTTTACAT TTGTTAAGCG TATGATCTTC
AAGTGGAAGT TTTGAATTTC TAGTATTTTC ATTTATTACA ACATTTTGAT GATTGTGGCA TTGTTTCCAG ATTGCATTGG
ATCAGCATTT AATGCCAAAG GCGTTATGCA ATGCCCCAAC TGCCGCAAAA TTGAAAAGGG GAACTGGCTC TATGCAAATG
GTTCCCGACC CACACAAGAT GTTAATATGG ATGAGTGGGC TCATGATGAA GACCTTTATG ATGTTAGTTA CTCGGAGATG
GTACGCAACC ATGTTATCTT TAATTTTTTA TTTGTTTTTG TTGTGAATTA TCTTTTTCCT TTCTAATCTT TAATTTATTA
TTTGTTTTTG TTGTGAATTG TCTTTTACCT TTCTTGTTTG CCACATGCTA TCCCATCATG TTTTTACTAG TTTACCTGAT
CATCAATATG GTTTCTTCGA CTTGTTCTTT TCTTACAAAT GATTCACTTG ACTAAACCTT TTCTTTTGGA GACATCTGTG
TTGCTACGTG AATATGTCTT CTATGCCGAT ATTCCCTTCA GATCAAGATC TTTAGTTATG GGCCTCTTGA CAGCGGAATT
CATTTATAAT CGTTCTTATA GGTTGCCACT GGCAGCTTTT GTGAATTGCA TTACTGTTGT TTTTCTGTTC TCCAATTTAG
TCACTTGAGG CCATGTTCTC TCTGTGAAGA AAACAATATG GGAGTTTTGA ACAAGTGCAG TGTGCATTCT TGCAAATGAT
CTAGATTCTA GTTCTTTTGT CAGTTGAAGG TTAAACTCGA GAGAAGTAAT ACATTAGAGG TCACAGCTGT TTTTTTATGT
GTACACACTA TGGTGCATCA GTACTGACTC CTTATTTACT TGAAGTAAAT TTGTCATTTT CCCTATTATT ATGCTTAACA
TTGTGCACAA AGTAATAATT CTGAGATGAA AGTTGTCACA GCTTATTCAA TCATGCTACA CATATGCACT AACTAATTGC
ATTTTCTAAA AGATTTATGC TACTTACATA GTTGGTTTTC ATTATTATTG ATTTTTCATT TTCTGTCATC ATTTGAGCTT
ACGGAGGCAG TTACTCTAGA TTCTGTTCTG AGTTCTGACA ACAATGTATT TGAATTGTGC AGCCCTTTCG GTTTCACTGG
TGCCCATTTG GTCGTTTGGC TCAACTTCCA TCCTTCTTTG AGTATGTTCT GCAGTCTTCG CTTGAAATTG TGGTTTATCG
TTTTATTTCA CCTTTCCAAT TGTCCAGTTC TATTTCTAGC TCAGCACTAT AAGATCTTTC AAGTATAGTA ATAATATAAA
ACACCATTGA ATTTGCGGGT AGTGAAAATT GGTCTTATGA GGTACTATAA CTAGATGTTG TATTTATGTT GGTCCATTAG
CGATGCTATC TATACTCTAT ACTCCTCAAA AAGATTCCAA TGGTGGTGGC ATTGAATCTG CCACCCCACC CACTCCTTTT
GTAGATTTTA CATATTACCC CTTGAACTTT TAATGTTACA TAACAACTAA ATCTAGGTGG ATAGCCACAT ATACAATTAA
ATTAAGGTGG GTATTCCCTA TAACAAAAAG ACGGGTAACA TATACATTTC ATGAAAAATA TGTTATTGCT TATTTTAGGC
AATATTATGA AAATATTCTT TTATCTATCC ATAGCAAAGC ATATGGGTAT TTAGCTAGTG TTTTGAAAAA TTAATAAGCA
AATGAGTTAA CTCTAGGACC TGTAATATCA ACAATCTGTT TTAGGGAGGG ATGAATATAA GGTGAATGGC CTTTCAATTC
TCGGTGATGA AGTGCGGAAC AATATACATT TTTTCTTAGG TTTAGTCCTA TCATGATGCA TTTGGTTTTT GACAATCTCC
GTGCTAGTTC TCTTTCCATG AGACTCTAAC TCTACTTTGC ATGGATCTTC TGACAAGCCA CTGTCTATTG CTTGTATATA
CCAATATGTC AGTATACCAT TTGACCAAAG TGCTGATCAG ACTACTGGTG ACAGCATTAA TGATGATACC ATTAAGCCAT
ATTGTCTTTC CCGATACCGA TTGCAGTCAG TGAACATATC AATTCTTTAA GTTCTATCTT TTGCTGCACC CTTCTCTTAA
CACCAACTAT TGTCTGTGCA AAATCTATAG CACGCTATAT TAAAAGTTTC AGAGTTTCAT TGTTTGAAAT TGGTGCTATG
TAATATTATG TTCCTCACTT AATGTTCCCC TCTTTTGCCA GGGAAGGAGA ATCATCACCC CCAGTTACTT GTAAGTTCTT
ATTTAAATGG GATCATTTTG TAAAACAATA GCTATATTGA GTTTGAAATA TGTCTTGATA TTGGCCATGC AGTTCATGAC
TTCATGGGAC AACATATGTT TACGGAGCAT GTAGCTGCTG TATCTTCTGC ACCTGGGGCA GCTCATCCAT GCCCATATGT
GGCATACTTG CATCCTCTTC CATCATTGGC GTCATCATCA AGCTCTCATG TTCCTGAGAG AACTATGGAT GGTCCTGCAT
ATCATGATCC CTGGCACCCC TTGGCTGGGC CTTCAGATGG TAGGCCCTTG CAATCAGTGC AACCTGCTGA TTTTCATCAT
AACCATTGGG CGCATGTTCC CAATTCCTAT CCTCAACCCA ACAACAATAA TGGGGTGGCC GAGCAGCAAG GAGTCCCTTT
TGGAACAACG AGGGCTGCAA GAGTTGATGG TGATACCCAA CGTCGAGGAT CATCTATTTC TCCATCATAC TTCAGTAATG
GGTAATTACT TATTCATTTC TGCTCAATCT ACTAATTTGT CCTTGTTTTT GTTGCCATGT ACTTTATCAG AACACATATC
AGATTAGTAA AATCAGTAAA CAATGGAAAA TTGTGTTGGG TACCAAAAAA GACATTGTAC GCATCCGTGT CCTATTCTGC
TACCATTTTT ACCAATACTG TTTGTCCACG TTTCCTTTGC TGGTTTTATC ATGCTCTGTT TTAACCTGAT GCTATAACAA
CTTTCACAAA TACAATTTTG TATTTTTGTT TATGCTATAA CAAAAAAAAT GGGAACCTGA TGGTGAAATC AATAATAAGC
TTGTAAGCAT GAGTGTCAGG CTAAGATCTT ATACAGGCAA GAATAAATTC CTAAAATTAC TTCAAATTCA AAATCTTCTT
TTGTAGAAGA GACTATTGCA TTATTATGCA GCTTCTGATT TTCATAAAAA TGCAGCTTCT GATTCTTCAA TGACGAATAT
GTAGTTATGA CTACCTTTTT TTTTTTTGCA GATCTGGTTC TAGATCTAGA GCTCCTAATG TTCCTCCTAT GGTACCTCAA
TTCATGAGGG CGCACGGCAG CATTAGTGAA CAGTACCAGC AGAGTTCATC ATCCAGCTTA TTTGCTGGGG CTCATAGATC
AGGAGGCATG CGAACTGCAC CGCCGCCCCC TCTACCAGAG AACCCGGCAT TTTGCCTTTT CCCACCAGGT TCATCTGGCC
ATAACTCGAT GGAGACTGAT GATGCAGGAG GAAACCGATT CTATGCCTGG GAACGGGATC GCTTCGCACC ATACCCACTA
ATGCCAGTGG ACTGTGAGAC AAACTGGTGG AGTTCACAAC AATCTCATGG TACATCAGAA CCCGCGCCTG CTCCAAGGAG
ACTATTTGGG CAATGGATTG GTGTTGGAAG ATCATCTCCG GAAAATCGAT CACCCGAGGG CTCATCGTAT CGGCAAATGC
ACACCCCAAG GATGTAGACC CTCATGAAGG GAATTTAAGT TAATACTTAA CATTTGAAAT CTGAAGTTGC TTGTAAGAAG
ATGGAAAACC CATTGTATGA AATTAAGCCC GGGTCGTGCC GTAAGCCTCG AAGCAAATCT GAGAAGAAGA AACAGAAAAT
AACCCGGGGT GGACATTTTG ATTTGGTTTA TTGAGTTCCA TCACGTACAT ATTTGAAATC AAGTTGGGAT ATTCGGAGTT

Locus: Os05g0154600

Loading...

Locus: Os05g0154600

Loading...