Os05t0154600-02

Locus

Os05g0154600

Description

Similar to VIP2 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

APIP6

Oryzabase Gene Name Synonym(s)

AvrPiz-t Interacting Protein 6

Transcript Evidence

AK104006 (DDBJ, Best hit)

Protein Evidence

Q9M4C5 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

001-002-F10 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0154600-02)

RiceXPro (AK104006)

Others

Oryzabase (11676)

KEGG (Os05t0154600-02)

Transcript

458 bp

>Os05t0154600-02 Similar to VIP2 protein.
AATGCCAGTGGACTGTGAGACAAACTGGTGGAGTTCACAACAATCTCATGGTACATCAGA
ACCCGCGCCTGCTCCAAGGAGACTATTTGGGCAATGGATTGGTGTTGGAAGATCATCTCC
GGAAAATCGATCACCCGAGGGCTCATCGTATCGGCAAATGCACACCCCAAGGATGTAGAC
CCTCATGAAGGGAATTTAAGTTAATACTTAACATTTGAAATCTGAAGTTGCTTGTAAGAA
GATGGAAAACCCATTGTATGAAATTAAGCCCGGGTCGTGCCGTAAGCCTCGAAGCAAATC
TGAGAAGAAGAAACAGAAAATAACCCGGGGTGGACATTTTGATTTGGTTTATTGAGTTCC
ATCACGTACATATTTGAAATCAAGTTGGGATATTCGGAGTTTCACCTGTGATACAGtttc
gtattatgcaatttgtttaattcatatacttttgcatT

CDS

177 bp

>Os05t0154600-02 Similar to VIP2 protein.
ATGCCAGTGGACTGTGAGACAAACTGGTGGAGTTCACAACAATCTCATGGTACATCAGAA
CCCGCGCCTGCTCCAAGGAGACTATTTGGGCAATGGATTGGTGTTGGAAGATCATCTCCG
GAAAATCGATCACCCGAGGGCTCATCGTATCGGCAAATGCACACCCCAAGGATGTAG

Protein

59 aa

>Os05t0154600-02 Similar to VIP2 protein.
MPVDCETNWWSSQQSHGTSEPAPAPRRLFGQWIGVGRSSPENRSPEGSSYRQMHTPRM*

5'UTR

chr05:3190252..3190252 (- strand) : 1 bp

CDS

chr05:3190075..3190251 (- strand) : 177 bp

3'UTR

chr05:3189795..3190074 (- strand) : 280 bp

FASTA

>Os05t0154600-02 class=Sequence position=chr05:3189795..3190252 (- strand)
AATGCCAGTG GACTGTGAGA CAAACTGGTG GAGTTCACAA CAATCTCATG GTACATCAGA ACCCGCGCCT GCTCCAAGGA
GACTATTTGG GCAATGGATT GGTGTTGGAA GATCATCTCC GGAAAATCGA TCACCCGAGG GCTCATCGTA TCGGCAAATG
CACACCCCAA GGATGTAGAC CCTCATGAAG GGAATTTAAG TTAATACTTA ACATTTGAAA TCTGAAGTTG CTTGTAAGAA
GATGGAAAAC CCATTGTATG AAATTAAGCC CGGGTCGTGC CGTAAGCCTC GAAGCAAATC TGAGAAGAAG AAACAGAAAA
TAACCCGGGG TGGACATTTT GATTTGGTTT ATTGAGTTCC ATCACGTACA TATTTGAAAT CAAGTTGGGA TATTCGGAGT
TTCACCTGTG ATACAGtttc gtattatgca atttgtttaa ttcatatact tttgcatT

Locus: Os05g0154600

Loading...

Locus: Os05g0154600

Loading...