Os05t0155200-01

Locus

Os05g0155200

Description

Similar to Ethylene receptor.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ERS2

CGSNL Gene Name

ETHYLENE RESPONSE SENSOR 2

Oryzabase Gene Symbol Synonym(s)

OS-ERS2, OsERS2, OsERS2a, OsERS2b, OsERS2c

Oryzabase Gene Name Synonym(s)

ETHYLENE RECEPTOR, ETHYLENE RESPONSE SENSOR2

Transcript Evidence

AK111696 (DDBJ, Best hit)

Protein Evidence

A1IIY0 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: signal transduction (GO:0007165)

Biological Process: peptidyl-histidine phosphorylation (GO:0018106)

Cellular Component: membrane (GO:0016020)

Molecular Function: two-component sensor activity (GO:0000155)

Molecular Function: protein histidine kinase activity (GO:0004673)

Molecular Function: signal transducer activity (GO:0004871)

Molecular Function: protein binding (GO:0005515)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

GAF (IPR003018)

ATPase-like, ATP-binding domain (IPR003594)

Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor domain (IPR003661)

Signal transduction histidine kinase, core (IPR005467)

Signal transduction histidine kinase, homodimeric (IPR009082)

Full-length cDNA

J023007F11 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0155200-01)

RiceXPro (AK111696)

Others

Oryzabase (9858)

KEGG (Os05t0155200-01)

Transcript

3452 bp

>Os05t0155200-01 Similar to Ethylene receptor.
AGTTTTTCTGTTCCTGATTAGCGGCGGAGTGTGCCGTCCTCGCTTTCACATCCAATCAAT
ACCAAGAAAAAATAAGAGCTTTTTTTTTAACGCTAATAATCCGAAGCACTCCCTGAATCC
AACCCATCCGCGGCTGCTGCTGCTGCAGCAGAGATGACAAATCAGATCGAGCCGGGAGCT
CTGGTTGTTCGTCTCTCGGTTCAGGTCAACACCTCGGGAGTTCTTGCTTCGGTTTGAAGC
GAGGAGCTCTGTTCTTTTCCCCGTTTCTTGGTACTGGTGATTCTTGGCTTCGCCGTGCTG
GAATCGGTGCAGCTTTAGGGGGGGATTTGGGGGAGGTTTTGATGCGATTCAGAGAGTAAA
GCTACATCATTTCTTGCATTTCGCGTGGTTCTTGGGGGTGGATTCTTTGCGTGGTTCTGT
CGAGGTCGAGCTATTTCGACGCGTACTCCAGTCTGAACCTTCTCAGAGATCCAGGTTAGA
TTGTGGTGGCTGCTTGTTTCAAGAACTTCAACACCCTGATTAACTCTTTCTGCTGATAAG
TAGATGGATGGATCATGTGATTGCATTGAGCCGCTCTGGCAGGCGGATGATCTCCTTGTA
AAGTATCAGTACATATCTGACTTCTTTATTGCGCTCGCTTACTTCTCGATCCCTTTGGAG
CTCATATATTTCGTTAAGAAGTCAGCATTCTTCCCTTACCGATGGGTGCTTATACAATTC
GGCGCATTCATTGTTCTTTGTGGGGCAACCCACCTGATAAATTTGTGGACTTTTGCCATA
TATACCAAGACTATAGCTGTGGTACTGACAGTGGCGAAAGCAGCGACAGCGGTTGTTTCG
TGCATCACAGCTTTGATGCTTGTGCATATAATTCCTGATTTGTTGAATGTGAAGTTGAGA
GAGAGATTTCTGAAGGATAAGGCTGATGAGCTTGATAGAGAGATGGGGATTATAAGAACA
CAAGAGGAGACAGGAAGACATGTCCACATGCTGACCCATGAGATAAGAAGCACACTTGAC
AGGCACACCATTCTGCGAACTACGCTCGTCGAGCTGGGAAGGACTCTTGTTTTAGCGGAG
TGTGCCCTGTGGATGCCAACACGCTCTGGATCGGCCCTTCAGCTCTCTCATACGATATAT
AACAGCGCAGCAATTGGATCAGTTGTTCCTATCAACCTTCCCATTGTCAGTAAGGTTTTT
AATAGTAACCGTGTAGTAAAAATTCCGCATACCTCCCCGTTAGCTTCGATAACGGCTGAC
AAAAGCAGGTATGTGCCACCAGAGGTTGTGGCTATCCGTGTTCCACTGCTGCACCTTACG
AATTTCCAAATAAATGATTGGCCTGAGCTATCTGCAAAAAGCTTTGCAGTAATGGTTTTG
ATGCTCCCTCCAGACAGTGCAAGAGAATGGCGGCCGCATGAACGGGAGCTTGTTGAAGTC
GTTGCTGATCAGGTAGCGGTCGCATTGTCTCATGCTGCCATTTTGGAAGAGTCCATGCGG
GCCCGTGATCTACTAATGGAGCAAAACATTGCTCTTGATGCAGCACGTCGGGAGGCAGAA
ATGGCTATTTGTGCCCGTAATGATTTTCTTGCTGTAATGAACCATGAAATGCGGACTCCT
ATGCGAGCAATCGTTTCTTTGTCCTCTCTCCTTTTAGAAACAAATCTTAGTGCTGAACAA
CGCCTAATGGTTGAGACTATACTAAAGAGTAGCGATCTTCTGGCAACTCTTACGAATGAT
GTTTTGGACGTTTCAAAGCTTGAGAATGGGAGTCTTGAGCTGGAAATTGCACCTTTTAAT
TTGCATTCCACCTTTACAGATGTGGTTAATTTGATTAAGCCAGTAGCAGCGTGCAAGAGG
CTCTCGGTTATGGTCACTTTGGCACCAGAGTTACCTCTACATGCTATTGGTGATCAAAAG
CGATTGATGCAAATAATCCTAAATGTTGCCGGGAACTCCATTAAGTTCACAAAGGAGGGT
CATGTTTCGATTACAGCTTCTATGGCCAGACCAGATGCTTTGAGAGGTCCACATGAACCT
GACTACCATCCAGTTGTCTCTGATGGATTCTTTTACCTGGCTGTTCAGGTTTGCTCATGA
ACATTTTCTATGTTCGCTACTTCCTCTTATCTCCAGTCTATTAAGATTATAGTTATACAT
GGTTGAACTTTATCTGTTACTTGTTATTATGCTTCACAAGTTCACCTGTGTGTTGTAGCG
CATCTAATGTCCAACAAACCACTGATTTAGTTCTCGCAATCTGTATAAGTTGCCTTGTTT
TGTGTTAGAGGGATATTAAGATAGGATACCACGTACTAAACATTTAGTTGTTTTATGACT
TGATCTTTTTTCTATTTCTGTAGGTAAAAGACACAGGCTGCGGAATCAGCCCTCAGGATA
TGCCCCACACATTCAGAAAGTTTGCACACCCTGAAAACGCAGGCAAATGGAACAGTGGCA
GTGGATTGGGGCTGGCCCTTTCCAGAAGATTTGTCAGTCTAATGGAAGGTAACATCTGGC
TCGAGAGCGAAGGCGTCGGGAAGGGCTGTACCGCGATGTTCTTTGTGAAACTTGGCATGC
CTGAGAAACCAAATGCAAACCTCCGAAGAATGGCGCCGCACCCTCTACAGCCAAACCAAG
GAGCTGGAGGCCCTGATGCCCTCAGTATATCCATAATGGACAGCAACCCGAGGGTTCCTC
GGGTTCGCTACCAATCAAGCGTATGAGAAGCACCGATGATGCCATCGCCATGCCAAGGCA
GAGCATCCGACCCAGTTTTGCCATCACAGTTTACAGCTCCATTTGCAGCTCTCTTTTTGA
TGTATGGATGGTAGATGTTGTTCTTGTCCATCAGTGGAGGTACCTTGGGCATGCTGGTAT
AAGTTTCATTGGCATTCTTGAATCTTGATTTCAGTTGTGAGGGTGATTGGGTGGTCTTAA
GTGGTGACAATTGTGAAAGCTGATGTAGTGATCTTTTGCAGCTCTCTTTTTGATGTATGG
ATGGTAGATGTTGTTCTTGTCCATCAGTAGAGGTACCTTTTGGGCATGATGGTATAAGTT
TCATTGGCATTCTTGATTGCAGTTGTGAGGGCGATTGGGTGATCTTAAGTGGTGACAATT
GGGAAAGCTGATGTAGTGATCTGTTGTCTGCACGAGTCTGAAGTTACTGGGAAGTGCCAA
TTTACTGCAAGTGACAGTGAACATGAAGGTCTATGGCCATCTTACATCTCTGATACCCTG
AGCTATAGAAGAGCTTGGACGAACGTGTTTATTTTTCTTACTTTTTTTTCCCTAGATTAG
GGCTACAACCTGGAAGGGATCGATCTACTAGCTGATTGCAGTATCATTTGTACTTTTTGT
TTTTTTTTTCTGAAATAAGAGTATCAGTGGTAATTGTAAGCGTTACTGCAGTGCTTTATA
AGCACAAGCAAATTATCATCAAATCAAATTAT

CDS

1557 bp

>Os05t0155200-01 Similar to Ethylene receptor.
ATGGATGGATCATGTGATTGCATTGAGCCGCTCTGGCAGGCGGATGATCTCCTTGTAAAG
TATCAGTACATATCTGACTTCTTTATTGCGCTCGCTTACTTCTCGATCCCTTTGGAGCTC
ATATATTTCGTTAAGAAGTCAGCATTCTTCCCTTACCGATGGGTGCTTATACAATTCGGC
GCATTCATTGTTCTTTGTGGGGCAACCCACCTGATAAATTTGTGGACTTTTGCCATATAT
ACCAAGACTATAGCTGTGGTACTGACAGTGGCGAAAGCAGCGACAGCGGTTGTTTCGTGC
ATCACAGCTTTGATGCTTGTGCATATAATTCCTGATTTGTTGAATGTGAAGTTGAGAGAG
AGATTTCTGAAGGATAAGGCTGATGAGCTTGATAGAGAGATGGGGATTATAAGAACACAA
GAGGAGACAGGAAGACATGTCCACATGCTGACCCATGAGATAAGAAGCACACTTGACAGG
CACACCATTCTGCGAACTACGCTCGTCGAGCTGGGAAGGACTCTTGTTTTAGCGGAGTGT
GCCCTGTGGATGCCAACACGCTCTGGATCGGCCCTTCAGCTCTCTCATACGATATATAAC
AGCGCAGCAATTGGATCAGTTGTTCCTATCAACCTTCCCATTGTCAGTAAGGTTTTTAAT
AGTAACCGTGTAGTAAAAATTCCGCATACCTCCCCGTTAGCTTCGATAACGGCTGACAAA
AGCAGGTATGTGCCACCAGAGGTTGTGGCTATCCGTGTTCCACTGCTGCACCTTACGAAT
TTCCAAATAAATGATTGGCCTGAGCTATCTGCAAAAAGCTTTGCAGTAATGGTTTTGATG
CTCCCTCCAGACAGTGCAAGAGAATGGCGGCCGCATGAACGGGAGCTTGTTGAAGTCGTT
GCTGATCAGGTAGCGGTCGCATTGTCTCATGCTGCCATTTTGGAAGAGTCCATGCGGGCC
CGTGATCTACTAATGGAGCAAAACATTGCTCTTGATGCAGCACGTCGGGAGGCAGAAATG
GCTATTTGTGCCCGTAATGATTTTCTTGCTGTAATGAACCATGAAATGCGGACTCCTATG
CGAGCAATCGTTTCTTTGTCCTCTCTCCTTTTAGAAACAAATCTTAGTGCTGAACAACGC
CTAATGGTTGAGACTATACTAAAGAGTAGCGATCTTCTGGCAACTCTTACGAATGATGTT
TTGGACGTTTCAAAGCTTGAGAATGGGAGTCTTGAGCTGGAAATTGCACCTTTTAATTTG
CATTCCACCTTTACAGATGTGGTTAATTTGATTAAGCCAGTAGCAGCGTGCAAGAGGCTC
TCGGTTATGGTCACTTTGGCACCAGAGTTACCTCTACATGCTATTGGTGATCAAAAGCGA
TTGATGCAAATAATCCTAAATGTTGCCGGGAACTCCATTAAGTTCACAAAGGAGGGTCAT
GTTTCGATTACAGCTTCTATGGCCAGACCAGATGCTTTGAGAGGTCCACATGAACCTGAC
TACCATCCAGTTGTCTCTGATGGATTCTTTTACCTGGCTGTTCAGGTTTGCTCATGA

Protein

519 aa

>Os05t0155200-01 Similar to Ethylene receptor.
MDGSCDCIEPLWQADDLLVKYQYISDFFIALAYFSIPLELIYFVKKSAFFPYRWVLIQFG
AFIVLCGATHLINLWTFAIYTKTIAVVLTVAKAATAVVSCITALMLVHIIPDLLNVKLRE
RFLKDKADELDREMGIIRTQEETGRHVHMLTHEIRSTLDRHTILRTTLVELGRTLVLAEC
ALWMPTRSGSALQLSHTIYNSAAIGSVVPINLPIVSKVFNSNRVVKIPHTSPLASITADK
SRYVPPEVVAIRVPLLHLTNFQINDWPELSAKSFAVMVLMLPPDSAREWRPHERELVEVV
ADQVAVALSHAAILEESMRARDLLMEQNIALDAARREAEMAICARNDFLAVMNHEMRTPM
RAIVSLSSLLLETNLSAEQRLMVETILKSSDLLATLTNDVLDVSKLENGSLELEIAPFNL
HSTFTDVVNLIKPVAACKRLSVMVTLAPELPLHAIGDQKRLMQIILNVAGNSIKFTKEGH
VSITASMARPDALRGPHEPDYHPVVSDGFFYLAVQVCS*

5'UTR

chr05:3236910..3237383 (- strand) : 474 bp

chr05:3236404..3236472 (- strand) : 69 bp

CDS

chr05:3235495..3236403 (- strand) : 909 bp

chr05:3234884..3235252 (- strand) : 369 bp

chr05:3234488..3234766 (- strand) : 279 bp

3'UTR

chr05:3234100..3234487 (- strand) : 388 bp

chr05:3233024..3233987 (- strand) : 964 bp

FASTA

>Os05t0155200-01 class=Sequence position=chr05:3233024..3237383 (- strand)
AGTTTTTCTG TTCCTGATTA GCGGCGGAGT GTGCCGTCCT CGCTTTCACA TCCAATCAAT ACCAAGAAAA AATAAGAGCT
TTTTTTTTAA CGCTAATAAT CCGAAGCACT CCCTGAATCC AACCCATCCG CGGCTGCTGC TGCTGCAGCA GAGATGACAA
ATCAGATCGA GCCGGGAGCT CTGGTTGTTC GTCTCTCGGT TCAGGTCAAC ACCTCGGGAG TTCTTGCTTC GGTTTGAAGC
GAGGAGCTCT GTTCTTTTCC CCGTTTCTTG GTACTGGTGA TTCTTGGCTT CGCCGTGCTG GAATCGGTGC AGCTTTAGGG
GGGGATTTGG GGGAGGTTTT GATGCGATTC AGAGAGTAAA GCTACATCAT TTCTTGCATT TCGCGTGGTT CTTGGGGGTG
GATTCTTTGC GTGGTTCTGT CGAGGTCGAG CTATTTCGAC GCGTACTCCA GTCTGAACCT TCTCAGAGAT CCAGGTTAGT
GTTTCTTGGT AAAGCTTTGC TTACTGCACT TCGCTTGAGG GCTAATTTAG GAGCAGTTTT GATGATTCGA TGTATTTTGT
TCATATGTTC ATGCTTGGGC AAGCTGCAGA TTCATTGTTA CTAGTCTTAG TCATACTTGT TACTAGACTG ATTATAATTA
TTTACACGTA CCATAATGGT TTAAGTGATG ATTGTTGTGC ATGCATTTTG TGTCTTTTAG AGATCTTGGT AGTAATATTT
TACCTGGTTT AACTCAACTA GAGTTTGTCA TGTAGAACTT TGCTTATGGA TGCATTATGG TTTTTGCAGT TCATGTTCCC
TCTAGTCTAA CAAATTATTT CTGTACTTTG AGAATTGTTC TCTTTTCATA GTTTTATTTG AGTTGTTTTC ATTTAAAAGT
AGTTTAAGAA TTTGATGGTA TGCTCTCACA GGTTAGATTG TGGTGGCTGC TTGTTTCAAG AACTTCAACA CCCTGATTAA
CTCTTTCTGC TGATAAGTAG ATGGATGGAT CATGTGATTG CATTGAGCCG CTCTGGCAGG CGGATGATCT CCTTGTAAAG
TATCAGTACA TATCTGACTT CTTTATTGCG CTCGCTTACT TCTCGATCCC TTTGGAGCTC ATATATTTCG TTAAGAAGTC
AGCATTCTTC CCTTACCGAT GGGTGCTTAT ACAATTCGGC GCATTCATTG TTCTTTGTGG GGCAACCCAC CTGATAAATT
TGTGGACTTT TGCCATATAT ACCAAGACTA TAGCTGTGGT ACTGACAGTG GCGAAAGCAG CGACAGCGGT TGTTTCGTGC
ATCACAGCTT TGATGCTTGT GCATATAATT CCTGATTTGT TGAATGTGAA GTTGAGAGAG AGATTTCTGA AGGATAAGGC
TGATGAGCTT GATAGAGAGA TGGGGATTAT AAGAACACAA GAGGAGACAG GAAGACATGT CCACATGCTG ACCCATGAGA
TAAGAAGCAC ACTTGACAGG CACACCATTC TGCGAACTAC GCTCGTCGAG CTGGGAAGGA CTCTTGTTTT AGCGGAGTGT
GCCCTGTGGA TGCCAACACG CTCTGGATCG GCCCTTCAGC TCTCTCATAC GATATATAAC AGCGCAGCAA TTGGATCAGT
TGTTCCTATC AACCTTCCCA TTGTCAGTAA GGTTTTTAAT AGTAACCGTG TAGTAAAAAT TCCGCATACC TCCCCGTTAG
CTTCGATAAC GGCTGACAAA AGCAGGTATG TGCCACCAGA GGTTGTGGCT ATCCGTGTTC CACTGCTGCA CCTTACGAAT
TTCCAAATAA ATGATTGGCC TGAGCTATCT GCAAAAAGCT TTGCAGTAAT GGTTTTGATG CTCCCTCCAG ACAGTGCAAG
AGAATGGCGG CCGCATGAAC GGGAGCTTGT TGAAGTCGTT GCTGATCAGG TAGTTATCAG TTTCATTTAT GTGCATTCCT
CTATATATGT AATCAAAATC AAAGGTGTGA TTTTCTGATA CCCGATATCT TGAATCTGGT GATATCAGGT TTAGTCTGAT
ATTGTTTGGT AGAGAACTAG AGAATCAATT AAATAGAGAA ATTTAACCAT TTATGTTGGT GTGACCTGTG AACTAAGTTT
TCTTGAAAAT TGTGAAAATC CTAAACCCAT GGCCTCATTT TTCTCATTCA GGTAGCGGTC GCATTGTCTC ATGCTGCCAT
TTTGGAAGAG TCCATGCGGG CCCGTGATCT ACTAATGGAG CAAAACATTG CTCTTGATGC AGCACGTCGG GAGGCAGAAA
TGGCTATTTG TGCCCGTAAT GATTTTCTTG CTGTAATGAA CCATGAAATG CGGACTCCTA TGCGAGCAAT CGTTTCTTTG
TCCTCTCTCC TTTTAGAAAC AAATCTTAGT GCTGAACAAC GCCTAATGGT TGAGACTATA CTAAAGAGTA GCGATCTTCT
GGCAACTCTT ACGAATGATG TTTTGGACGT TTCAAAGCTT GAGAATGGGA GTCTTGAGCT GGAAATTGCA CCTTTTAATT
TGCATTCCAC CTTTACAGAT GTGAGTCCCC TCTCTGTGAT TTAGGATTTG CTGTTATGTT GCCTGGAAAG TAAGAAATGG
AGATCTTTGC TATTTTTCAT TAAGATTAAC TCGGTAGTTC ATCTTGTATT CTTGTAGGTG GTTAATTTGA TTAAGCCAGT
AGCAGCGTGC AAGAGGCTCT CGGTTATGGT CACTTTGGCA CCAGAGTTAC CTCTACATGC TATTGGTGAT CAAAAGCGAT
TGATGCAAAT AATCCTAAAT GTTGCCGGGA ACTCCATTAA GTTCACAAAG GAGGGTCATG TTTCGATTAC AGCTTCTATG
GCCAGACCAG ATGCTTTGAG AGGTCCACAT GAACCTGACT ACCATCCAGT TGTCTCTGAT GGATTCTTTT ACCTGGCTGT
TCAGGTTTGC TCATGAACAT TTTCTATGTT CGCTACTTCC TCTTATCTCC AGTCTATTAA GATTATAGTT ATACATGGTT
GAACTTTATC TGTTACTTGT TATTATGCTT CACAAGTTCA CCTGTGTGTT GTAGCGCATC TAATGTCCAA CAAACCACTG
ATTTAGTTCT CGCAATCTGT ATAAGTTGCC TTGTTTTGTG TTAGAGGGAT ATTAAGATAG GATACCACGT ACTAAACATT
TAGTTGTTTT ATGACTTGAT CTTTTTTCTA TTTCTGTAGG TAAAAGACAC AGGCTGCGGA ATCAGCCCTC AGGATATGCC
CCACACATTC AGAAAGTTTG CACACCCTGA AAACGCAGGC AAATGGAACA GTGGCAGTGG ATTGGGGCTG GCCCTTTCCA
GAAGGTATCC CAAGAAAACA TTGTTTTCAC ATATGCATCA TTTTTCCCTG GATCATTTTA CATATGCATC ATTTATCCCT
GTGCTAACAT ATGTTAACTA TCTCTTGCCA TATCAGATTT GTCAGTCTAA TGGAAGGTAA CATCTGGCTC GAGAGCGAAG
GCGTCGGGAA GGGCTGTACC GCGATGTTCT TTGTGAAACT TGGCATGCCT GAGAAACCAA ATGCAAACCT CCGAAGAATG
GCGCCGCACC CTCTACAGCC AAACCAAGGA GCTGGAGGCC CTGATGCCCT CAGTATATCC ATAATGGACA GCAACCCGAG
GGTTCCTCGG GTTCGCTACC AATCAAGCGT ATGAGAAGCA CCGATGATGC CATCGCCATG CCAAGGCAGA GCATCCGACC
CAGTTTTGCC ATCACAGTTT ACAGCTCCAT TTGCAGCTCT CTTTTTGATG TATGGATGGT AGATGTTGTT CTTGTCCATC
AGTGGAGGTA CCTTGGGCAT GCTGGTATAA GTTTCATTGG CATTCTTGAA TCTTGATTTC AGTTGTGAGG GTGATTGGGT
GGTCTTAAGT GGTGACAATT GTGAAAGCTG ATGTAGTGAT CTTTTGCAGC TCTCTTTTTG ATGTATGGAT GGTAGATGTT
GTTCTTGTCC ATCAGTAGAG GTACCTTTTG GGCATGATGG TATAAGTTTC ATTGGCATTC TTGATTGCAG TTGTGAGGGC
GATTGGGTGA TCTTAAGTGG TGACAATTGG GAAAGCTGAT GTAGTGATCT GTTGTCTGCA CGAGTCTGAA GTTACTGGGA
AGTGCCAATT TACTGCAAGT GACAGTGAAC ATGAAGGTCT ATGGCCATCT TACATCTCTG ATACCCTGAG CTATAGAAGA
GCTTGGACGA ACGTGTTTAT TTTTCTTACT TTTTTTTCCC TAGATTAGGG CTACAACCTG GAAGGGATCG ATCTACTAGC
TGATTGCAGT ATCATTTGTA CTTTTTGTTT TTTTTTTCTG AAATAAGAGT ATCAGTGGTA ATTGTAAGCG TTACTGCAGT
GCTTTATAAG CACAAGCAAA TTATCATCAA ATCAAATTAT 

Locus: Os05g0155200

Loading...

Locus: Os05g0155200

Loading...