Os05t0155200-02

Locus

Os05g0155200

Description

Similar to Ethylene receptor-like protein (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ERS2

CGSNL Gene Name

ETHYLENE RESPONSE SENSOR 2

Oryzabase Gene Symbol Synonym(s)

OS-ERS2, OsERS2, OsERS2a, OsERS2b, OsERS2c

Oryzabase Gene Name Synonym(s)

ETHYLENE RECEPTOR, ETHYLENE RESPONSE SENSOR2

Transcript Evidence

AK111944 (DDBJ, Best hit)

Protein Evidence

Q8GT97 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: signal transduction (GO:0007165)

Biological Process: phosphorylation (GO:0016310)

Biological Process: peptidyl-histidine phosphorylation (GO:0018106)

Cellular Component: membrane (GO:0016020)

Molecular Function: two-component sensor activity (GO:0000155)

Molecular Function: protein histidine kinase activity (GO:0004673)

Molecular Function: signal transducer activity (GO:0004871)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

ATPase-like, ATP-binding domain (IPR003594)

Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor domain (IPR003661)

Signal transduction histidine kinase-related protein, C-terminal (IPR004358)

Signal transduction histidine kinase, core (IPR005467)

Signal transduction histidine kinase, homodimeric (IPR009082)

Full-length cDNA

001-022-C09 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0155200-02)

RiceXPro (AK111944)

Others

Oryzabase (9858)

KEGG (Os05t0155200-02)

Transcript

1414 bp

>Os05t0155200-02 Similar to Ethylene receptor-like protein (Fragment).
ATGATTGGCCTGAGCTATCTGCAAAAAGCTTTGCAGTAATGGTTTTGATGCTCCCTCCAG
ACAGTGCAAGAGAATGGCGGCCGCATGAACGGGAGCTTGTTGAAGTCGTTGCTGATCAGG
TAGCGGTCGCATTGTCTCATGCTGCCATTTTGGAAGAGTCCATGCGGGCCCGTGATCTAC
TAATGGAGCAAAACATTGCTCTTGATGCAGCACGTCGGGAGGCAGAAATGGCTATTTGTG
CCCGTAATGATTTTCTTGCTGTAATGAACCATGAAATGCGGACTCCTATGCGAGCAATCG
TTTCTTTGTCCTCTCTCCTTTTAGAAACAAATCTTAGTGCTGAACAACGCCTAATGGTTG
AGACTATACTAAAGAGTAGCGATCTTCTGGCAACTCTTACGAATGATGTTTTGGACGTTT
CAAAGCTTGAGAATGGGAGTCTTGAGCTGGAAATTGCACCTTTTAATTTGCATTCCACCT
TTACAGATGTGGTTAATTTGATTAAGCCAGTAGCAGCGTGCAAGAGGCTCTCGGTTATGG
TCACTTTGGCACCAGAGTTACCTCTACATGCTATTGGTGATCAAAAGCGATTGATGCAAA
TAATCCTAAATGTTGCCGGGAACTCCATTAAGTTCACAAAGGAGGGTCATGTTTCGATTA
CAGCTTCTATGGCCAGACCAGATGCTTTGAGAGGTCCACATGAACCTGACTACCATCCAG
TTGTCTCTGATGGATTCTTTTACCTGGCTGTTCAGGTAAAAGACACAGGCTGCGGAATCA
GCCCTCAGGATATGCCCCACACATTCAGAAAGTTTGCACACCCTGAAAACGCAGGCAAAT
GGAACAGTGGCAGTGGATTGGGGCTGGCCCTTTCCAGAAGATTTGTCAGTCTAATGGAAG
GTAACATCTGGCTCGAGAGCGAAGGCGTCGGGAAGGGCTGTACCGCGATGTTCTTTGTGA
AACTTGGCATGCCTGAGAAACCAAATGCAAACCTCCGAAGAATGGCGCCGCACCCTCTAC
AGCCAAACCAAGGAGCTGGAGGCCCTGATGCCCTCAGTATATCCATAATGGACAGCAACC
CGAGGGTTCCTCGGGTTCGCTACCAATCAAGCGTATGAGAAGCACCGATGATGCCATCGC
CATGCCAAGGCAGAGCATCCGACCCAGTTTTGCCATCACAGTTTACAGCTCCATTTGCAG
CTCTCTTTTTGATGTATGGATGGTAGATGTTGTTCTTGTCCATCAGTGGAGGTACCTTGG
GCATGCTGGTATAAGTTTCATTGGCATTCTTGAATCTTGATTTCAGTTGTGAGGGTGATT
GGGTGGTCTTAAGTGGTGACAATTGTGAAAGCTGATGTAGTGATCTTTTGCAGCTCTCTT
TTTGATGTATGGATGGTAGATGTTGTTCTTGTCC

CDS

1116 bp

>Os05t0155200-02 Similar to Ethylene receptor-like protein (Fragment).
GATTGGCCTGAGCTATCTGCAAAAAGCTTTGCAGTAATGGTTTTGATGCTCCCTCCAGAC
AGTGCAAGAGAATGGCGGCCGCATGAACGGGAGCTTGTTGAAGTCGTTGCTGATCAGGTA
GCGGTCGCATTGTCTCATGCTGCCATTTTGGAAGAGTCCATGCGGGCCCGTGATCTACTA
ATGGAGCAAAACATTGCTCTTGATGCAGCACGTCGGGAGGCAGAAATGGCTATTTGTGCC
CGTAATGATTTTCTTGCTGTAATGAACCATGAAATGCGGACTCCTATGCGAGCAATCGTT
TCTTTGTCCTCTCTCCTTTTAGAAACAAATCTTAGTGCTGAACAACGCCTAATGGTTGAG
ACTATACTAAAGAGTAGCGATCTTCTGGCAACTCTTACGAATGATGTTTTGGACGTTTCA
AAGCTTGAGAATGGGAGTCTTGAGCTGGAAATTGCACCTTTTAATTTGCATTCCACCTTT
ACAGATGTGGTTAATTTGATTAAGCCAGTAGCAGCGTGCAAGAGGCTCTCGGTTATGGTC
ACTTTGGCACCAGAGTTACCTCTACATGCTATTGGTGATCAAAAGCGATTGATGCAAATA
ATCCTAAATGTTGCCGGGAACTCCATTAAGTTCACAAAGGAGGGTCATGTTTCGATTACA
GCTTCTATGGCCAGACCAGATGCTTTGAGAGGTCCACATGAACCTGACTACCATCCAGTT
GTCTCTGATGGATTCTTTTACCTGGCTGTTCAGGTAAAAGACACAGGCTGCGGAATCAGC
CCTCAGGATATGCCCCACACATTCAGAAAGTTTGCACACCCTGAAAACGCAGGCAAATGG
AACAGTGGCAGTGGATTGGGGCTGGCCCTTTCCAGAAGATTTGTCAGTCTAATGGAAGGT
AACATCTGGCTCGAGAGCGAAGGCGTCGGGAAGGGCTGTACCGCGATGTTCTTTGTGAAA
CTTGGCATGCCTGAGAAACCAAATGCAAACCTCCGAAGAATGGCGCCGCACCCTCTACAG
CCAAACCAAGGAGCTGGAGGCCCTGATGCCCTCAGTATATCCATAATGGACAGCAACCCG
AGGGTTCCTCGGGTTCGCTACCAATCAAGCGTATGA

Protein

372 aa

>Os05t0155200-02 Similar to Ethylene receptor-like protein (Fragment).
DWPELSAKSFAVMVLMLPPDSAREWRPHERELVEVVADQVAVALSHAAILEESMRARDLL
MEQNIALDAARREAEMAICARNDFLAVMNHEMRTPMRAIVSLSSLLLETNLSAEQRLMVE
TILKSSDLLATLTNDVLDVSKLENGSLELEIAPFNLHSTFTDVVNLIKPVAACKRLSVMV
TLAPELPLHAIGDQKRLMQIILNVAGNSIKFTKEGHVSITASMARPDALRGPHEPDYHPV
VSDGFFYLAVQVKDTGCGISPQDMPHTFRKFAHPENAGKWNSGSGLGLALSRRFVSLMEG
NIWLESEGVGKGCTAMFFVKLGMPEKPNANLRRMAPHPLQPNQGAGGPDALSISIMDSNP
RVPRVRYQSSV*

5'UTR

chr05:3235612..3235613 (- strand) : 2 bp

CDS

chr05:3235495..3235611 (- strand) : 117 bp

chr05:3234884..3235252 (- strand) : 369 bp

chr05:3234500..3234766 (- strand) : 267 bp

chr05:3234100..3234224 (- strand) : 125 bp

chr05:3233750..3233987 (- strand) : 238 bp

3'UTR

chr05:3233454..3233749 (- strand) : 296 bp

FASTA

>Os05t0155200-02 class=Sequence position=chr05:3233454..3235613 (- strand)
ATGATTGGCC TGAGCTATCT GCAAAAAGCT TTGCAGTAAT GGTTTTGATG CTCCCTCCAG ACAGTGCAAG AGAATGGCGG
CCGCATGAAC GGGAGCTTGT TGAAGTCGTT GCTGATCAGG TAGTTATCAG TTTCATTTAT GTGCATTCCT CTATATATGT
AATCAAAATC AAAGGTGTGA TTTTCTGATA CCCGATATCT TGAATCTGGT GATATCAGGT TTAGTCTGAT ATTGTTTGGT
AGAGAACTAG AGAATCAATT AAATAGAGAA ATTTAACCAT TTATGTTGGT GTGACCTGTG AACTAAGTTT TCTTGAAAAT
TGTGAAAATC CTAAACCCAT GGCCTCATTT TTCTCATTCA GGTAGCGGTC GCATTGTCTC ATGCTGCCAT TTTGGAAGAG
TCCATGCGGG CCCGTGATCT ACTAATGGAG CAAAACATTG CTCTTGATGC AGCACGTCGG GAGGCAGAAA TGGCTATTTG
TGCCCGTAAT GATTTTCTTG CTGTAATGAA CCATGAAATG CGGACTCCTA TGCGAGCAAT CGTTTCTTTG TCCTCTCTCC
TTTTAGAAAC AAATCTTAGT GCTGAACAAC GCCTAATGGT TGAGACTATA CTAAAGAGTA GCGATCTTCT GGCAACTCTT
ACGAATGATG TTTTGGACGT TTCAAAGCTT GAGAATGGGA GTCTTGAGCT GGAAATTGCA CCTTTTAATT TGCATTCCAC
CTTTACAGAT GTGAGTCCCC TCTCTGTGAT TTAGGATTTG CTGTTATGTT GCCTGGAAAG TAAGAAATGG AGATCTTTGC
TATTTTTCAT TAAGATTAAC TCGGTAGTTC ATCTTGTATT CTTGTAGGTG GTTAATTTGA TTAAGCCAGT AGCAGCGTGC
AAGAGGCTCT CGGTTATGGT CACTTTGGCA CCAGAGTTAC CTCTACATGC TATTGGTGAT CAAAAGCGAT TGATGCAAAT
AATCCTAAAT GTTGCCGGGA ACTCCATTAA GTTCACAAAG GAGGGTCATG TTTCGATTAC AGCTTCTATG GCCAGACCAG
ATGCTTTGAG AGGTCCACAT GAACCTGACT ACCATCCAGT TGTCTCTGAT GGATTCTTTT ACCTGGCTGT TCAGGTTTGC
TCATGAACAT TTTCTATGTT CGCTACTTCC TCTTATCTCC AGTCTATTAA GATTATAGTT ATACATGGTT GAACTTTATC
TGTTACTTGT TATTATGCTT CACAAGTTCA CCTGTGTGTT GTAGCGCATC TAATGTCCAA CAAACCACTG ATTTAGTTCT
CGCAATCTGT ATAAGTTGCC TTGTTTTGTG TTAGAGGGAT ATTAAGATAG GATACCACGT ACTAAACATT TAGTTGTTTT
ATGACTTGAT CTTTTTTCTA TTTCTGTAGG TAAAAGACAC AGGCTGCGGA ATCAGCCCTC AGGATATGCC CCACACATTC
AGAAAGTTTG CACACCCTGA AAACGCAGGC AAATGGAACA GTGGCAGTGG ATTGGGGCTG GCCCTTTCCA GAAGGTATCC
CAAGAAAACA TTGTTTTCAC ATATGCATCA TTTTTCCCTG GATCATTTTA CATATGCATC ATTTATCCCT GTGCTAACAT
ATGTTAACTA TCTCTTGCCA TATCAGATTT GTCAGTCTAA TGGAAGGTAA CATCTGGCTC GAGAGCGAAG GCGTCGGGAA
GGGCTGTACC GCGATGTTCT TTGTGAAACT TGGCATGCCT GAGAAACCAA ATGCAAACCT CCGAAGAATG GCGCCGCACC
CTCTACAGCC AAACCAAGGA GCTGGAGGCC CTGATGCCCT CAGTATATCC ATAATGGACA GCAACCCGAG GGTTCCTCGG
GTTCGCTACC AATCAAGCGT ATGAGAAGCA CCGATGATGC CATCGCCATG CCAAGGCAGA GCATCCGACC CAGTTTTGCC
ATCACAGTTT ACAGCTCCAT TTGCAGCTCT CTTTTTGATG TATGGATGGT AGATGTTGTT CTTGTCCATC AGTGGAGGTA
CCTTGGGCAT GCTGGTATAA GTTTCATTGG CATTCTTGAA TCTTGATTTC AGTTGTGAGG GTGATTGGGT GGTCTTAAGT
GGTGACAATT GTGAAAGCTG ATGTAGTGAT CTTTTGCAGC TCTCTTTTTG ATGTATGGAT GGTAGATGTT GTTCTTGTCC

Locus: Os05g0155200

Loading...

Locus: Os05g0155200

Loading...