Os05t0156900-01

Locus

Os05g0156900

Description

Vacuolar H+-translocating pyrophosphatase, Regulation of grain chalkiness

RAP-DB Gene Symbol Synonym(s)

Chalk5

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Chalk5

Oryzabase Gene Name Synonym(s)

Pyrophosphate-energized vacuolar membrane proton pump

Transcript Evidence

AK107275

KJ363317 (Zhenshan97, 9bp deletion)

Protein Evidence

Q75M03

A2Y0L3

Literature

PMID: 24633159

Note

Manual Curation

April 15, 2014

Gene Ontology (GO)

Biological Process: proton transport (GO:0015992)

Molecular Function: inorganic diphosphatase activity (GO:0004427)

Molecular Function: hydrogen-translocating pyrophosphatase activity (GO:0009678)

Cellular Component: membrane (GO:0016020)

Functional domain (InterPro)

Pyrophosphate-energised proton pump (IPR004131)

Full-length cDNA

002-126-A04 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0156900-01)

Others

Oryzabase (15662)

KEGG (Os05t0156900-01 (EC:3.6.1.1))

Transcript

2661 bp

>Os05t0156900-01 Vacuolar H+-translocating pyrophosphatase, Regulation of grain chalkiness
ACTCCACATCTCTTCTCCATCAAGAATCAATCACTCGCTCGTCTTCTCCTCCATTGGAGC
TCTCGATCGAGCTTAGCTTTGCGCTTCGTTCATCCATGGCGCTCATCGGCACGGTGGCGG
CCGAGGTGCTCATCCCGCTCGCGGCGGTGATCGGCATCCTCTTCGCCGTGCTCCAGTGGT
ACATGGTGTCCAGGGTGGCCGTCCCGCCGCACGACGGCGTCggcggcgccgggaaggtgg
agagggagagcgacggcggcgacggcgacggcgacggcgtcgacgacgaggaggacggcg
tggactaccggggcgtggaggcgaggtgcgcGGAGATCCAGCACGCCATCTCCGTGGGCG
CGACGTCGTTCCTGATGACGGAGTACAAGTACCTGGGCGCGTTCATGGCGGCGTTCGCGG
CGGTCATCTTCGTCTCGCTGGGCTCCGTGGGGCGGTTCTCCACGTCGACGGAGCCGTGCC
CGTACGACGCGGCGAGGCGGTGCCGCCCGGCGCTGGCGAACGCGGCGTTCACCGCGGCGG
CGTTCCTCCTCGGCGCCACCACCTCGGTGGTCTCCGGCTACCTCGGGATGCGGGTGGCGA
CGTTCGCGAACGCGAGGACGGCGCTGGAGGCTCGCCGCGGGATCGGGCGGGCGTTCGCGG
TGGCGTTCAGGTCGGGCGCCGCCATGGGGTTCCTGCTGGCGTCGAGCGCGCTGCTGGTGC
TGTTCGCCGCCGTGAACGCGTTCGGGCTCTACTACGGCGACGACTGGGGCGGGCTGTACG
AGGCGATCACCGGGTACGGGCTCGGGGGGTCGTCCATGGCGCTGTTCGGCCGCGTCGGCG
GCGGGATCTACACCAAGGCGGCCGACGTCGGCGCCGACCTCGTCGGCAAGGTGGAGCGCA
ACATCCCCGAGGATGACCCCCGCAACCCCGCGGTGATCGCCGACAACGTGGGCGACAACG
TGGGCGACATCGCCGGGATGGGGTCCGACCTGTTCGGGTCGTACGCGGAGTCGTCGTGCG
CGGCGCTGTTCGTGGCGTCCATCTCCTCCTTCGGCGCCGACCACGACTTCGCGGCGATGA
TGTACCCGCTGCTGGTGAGCGCCGCCGGCATCGTGGCCTGCGCCGCCACCACGCTCGTCG
CCACCGACGCCGGCGAGCTCGGCGCCGCCGACGAGGTCGCGCCCGCGCTCAAGCGCCAGA
TCCTCATCTCCACCGTGCTCATGACCGCCGCCGTCGCCGCCGTCACCTTCCTCTCCCTCC
CCCGCTCCTTCACCCTCTTCGACTTCGGCGAACGCAAGCTCGTCAAAAATTGGCACCTGT
TCATCTGCGTCTCAGCTGGTCTGTGGGCGGGATTGGTGATAGGCTACGTCACCGAGTACT
TCACGAGCAATGCTTACGGGCCGGTGCAGACGGTGGCGCAGTCGTGCCGGACGGGGGCGG
CGACGAACGTGATCTTCGGCCTCGCCGTGGGGTACAAGTCGGTGATCGTGCCGATCTTCG
CCATCGCCGGCGCCATCTACGCCAGCTTCCGGCTCGCCGCCATGTACGGCATCGCGCTGG
CTGCGCTGGGGATGCTGAGCACCATCGCCACGGGGCTCACCATCGACGCCTATGGCCCCA
TCAGCGACAACGCCGGCGGCATCGCGGAGATGGCCGGCATGCCGCGGCGCGTGCGCGAGC
GCACGGACGCGCTCGACGCCGCCGGGAACACGACGGCGGCGATCGGGAAGGGGTTCGCGA
TCGGGTCGGCGGCGCTGGTGTCGCTGGCGCTGTTCGGCGCGTACGTGAGCCGGGCGGGGA
TCCGGACGGTGAACGTGGTGAGCCCCAGGGTGTTCGTCGGGCTCCTCGCCGGCGCCATGC
TCCCCTACTGGTTCTCGGCGATGACGATGCGGAGCGTGGGGAGCGCGGCGCTGCGGATGG
TGGAGGAGGTGCGGCGCCAGTTCGACGAGATCCCGGGGCTCGCCGAGGGGCTCGCCGCGC
CGGACTACGCCACCTGCGTGAGGATCTCCACCGACGCGTCGCTGCGGGAGATGGTGGCGC
CGGGGGCGCTGGTGATGGCGAGCCCGCTCGTCGCCGGGACGCTGTTCGGGGTGGAGGCGC
TGGCGGGGCTGCTCGCCGGCGCGCTGGTGTCCGGGGTGCAGGTGGCGATCTCGGCGTCGA
ACAGCGGCGGCGCGTGGGACAACGCCAAGAAGTACATCGAGGCCGGGGCGACGGAGGAGG
CGAGGTCGCTGGGGCCCAAGGGCTCCGAGGCGCACAAGGCGGCGGTGATCGGGGACACCA
TCGGCGACCCGCTCAAGGACACCTCGGGGCCATCGCTCAACATCCTCGTCAAGCTCATGG
CCGTCGAGGCGCTCGTCTTCGCCCCCTTCTTCGCCGCGCATGGCGGCATCGTCTTCAACC
ACCTCTGATGAAGCTGAGCTCCATTGCTAATAAATTAAGCTGCATGCATGCTCTCGCCAT
GATCGATCAGCTGCACCTGCATGCACGCATGGATAAACAAGAAGAAGACGATGAGCATTA
GGGTTCCTTAACCAGTTGAAACCGATAAGAGTAATAATTGTAGCTCGGGATAATGCAGTG
TCAGATGTAATCCAAAGTGTCTTGTTGCTTGGGATATGTAATGCGGTTTGAGACTTAGGA
TGTAATCCAATGTTGTTTTAG

CDS

2313 bp

>Os05t0156900-01 Vacuolar H+-translocating pyrophosphatase, Regulation of grain chalkiness
ATGGCGCTCATCGGCACGGTGGCGGCCGAGGTGCTCATCCCGCTCGCGGCGGTGATCGGC
ATCCTCTTCGCCGTGCTCCAGTGGTACATGGTGTCCAGGGTGGCCGTCCCGCCGCACGAC
GGCGTCggcggcgccgggaaggtggagagggagagcgacggcggcgacggcgacggcgac
ggcgtcgacgacgaggaggacggcgtggactaccggggcgtggaggcgaggtgcgcGGAG
ATCCAGCACGCCATCTCCGTGGGCGCGACGTCGTTCCTGATGACGGAGTACAAGTACCTG
GGCGCGTTCATGGCGGCGTTCGCGGCGGTCATCTTCGTCTCGCTGGGCTCCGTGGGGCGG
TTCTCCACGTCGACGGAGCCGTGCCCGTACGACGCGGCGAGGCGGTGCCGCCCGGCGCTG
GCGAACGCGGCGTTCACCGCGGCGGCGTTCCTCCTCGGCGCCACCACCTCGGTGGTCTCC
GGCTACCTCGGGATGCGGGTGGCGACGTTCGCGAACGCGAGGACGGCGCTGGAGGCTCGC
CGCGGGATCGGGCGGGCGTTCGCGGTGGCGTTCAGGTCGGGCGCCGCCATGGGGTTCCTG
CTGGCGTCGAGCGCGCTGCTGGTGCTGTTCGCCGCCGTGAACGCGTTCGGGCTCTACTAC
GGCGACGACTGGGGCGGGCTGTACGAGGCGATCACCGGGTACGGGCTCGGGGGGTCGTCC
ATGGCGCTGTTCGGCCGCGTCGGCGGCGGGATCTACACCAAGGCGGCCGACGTCGGCGCC
GACCTCGTCGGCAAGGTGGAGCGCAACATCCCCGAGGATGACCCCCGCAACCCCGCGGTG
ATCGCCGACAACGTGGGCGACAACGTGGGCGACATCGCCGGGATGGGGTCCGACCTGTTC
GGGTCGTACGCGGAGTCGTCGTGCGCGGCGCTGTTCGTGGCGTCCATCTCCTCCTTCGGC
GCCGACCACGACTTCGCGGCGATGATGTACCCGCTGCTGGTGAGCGCCGCCGGCATCGTG
GCCTGCGCCGCCACCACGCTCGTCGCCACCGACGCCGGCGAGCTCGGCGCCGCCGACGAG
GTCGCGCCCGCGCTCAAGCGCCAGATCCTCATCTCCACCGTGCTCATGACCGCCGCCGTC
GCCGCCGTCACCTTCCTCTCCCTCCCCCGCTCCTTCACCCTCTTCGACTTCGGCGAACGC
AAGCTCGTCAAAAATTGGCACCTGTTCATCTGCGTCTCAGCTGGTCTGTGGGCGGGATTG
GTGATAGGCTACGTCACCGAGTACTTCACGAGCAATGCTTACGGGCCGGTGCAGACGGTG
GCGCAGTCGTGCCGGACGGGGGCGGCGACGAACGTGATCTTCGGCCTCGCCGTGGGGTAC
AAGTCGGTGATCGTGCCGATCTTCGCCATCGCCGGCGCCATCTACGCCAGCTTCCGGCTC
GCCGCCATGTACGGCATCGCGCTGGCTGCGCTGGGGATGCTGAGCACCATCGCCACGGGG
CTCACCATCGACGCCTATGGCCCCATCAGCGACAACGCCGGCGGCATCGCGGAGATGGCC
GGCATGCCGCGGCGCGTGCGCGAGCGCACGGACGCGCTCGACGCCGCCGGGAACACGACG
GCGGCGATCGGGAAGGGGTTCGCGATCGGGTCGGCGGCGCTGGTGTCGCTGGCGCTGTTC
GGCGCGTACGTGAGCCGGGCGGGGATCCGGACGGTGAACGTGGTGAGCCCCAGGGTGTTC
GTCGGGCTCCTCGCCGGCGCCATGCTCCCCTACTGGTTCTCGGCGATGACGATGCGGAGC
GTGGGGAGCGCGGCGCTGCGGATGGTGGAGGAGGTGCGGCGCCAGTTCGACGAGATCCCG
GGGCTCGCCGAGGGGCTCGCCGCGCCGGACTACGCCACCTGCGTGAGGATCTCCACCGAC
GCGTCGCTGCGGGAGATGGTGGCGCCGGGGGCGCTGGTGATGGCGAGCCCGCTCGTCGCC
GGGACGCTGTTCGGGGTGGAGGCGCTGGCGGGGCTGCTCGCCGGCGCGCTGGTGTCCGGG
GTGCAGGTGGCGATCTCGGCGTCGAACAGCGGCGGCGCGTGGGACAACGCCAAGAAGTAC
ATCGAGGCCGGGGCGACGGAGGAGGCGAGGTCGCTGGGGCCCAAGGGCTCCGAGGCGCAC
AAGGCGGCGGTGATCGGGGACACCATCGGCGACCCGCTCAAGGACACCTCGGGGCCATCG
CTCAACATCCTCGTCAAGCTCATGGCCGTCGAGGCGCTCGTCTTCGCCCCCTTCTTCGCC
GCGCATGGCGGCATCGTCTTCAACCACCTCTGA

Protein

771 aa

>Os05t0156900-01 Vacuolar H+-translocating pyrophosphatase, Regulation of grain chalkiness
MALIGTVAAEVLIPLAAVIGILFAVLQWYMVSRVAVPPHDGVGGAGKVERESDGGDGDGD
GVDDEEDGVDYRGVEARCAEIQHAISVGATSFLMTEYKYLGAFMAAFAAVIFVSLGSVGR
FSTSTEPCPYDAARRCRPALANAAFTAAAFLLGATTSVVSGYLGMRVATFANARTALEAR
RGIGRAFAVAFRSGAAMGFLLASSALLVLFAAVNAFGLYYGDDWGGLYEAITGYGLGGSS
MALFGRVGGGIYTKAADVGADLVGKVERNIPEDDPRNPAVIADNVGDNVGDIAGMGSDLF
GSYAESSCAALFVASISSFGADHDFAAMMYPLLVSAAGIVACAATTLVATDAGELGAADE
VAPALKRQILISTVLMTAAVAAVTFLSLPRSFTLFDFGERKLVKNWHLFICVSAGLWAGL
VIGYVTEYFTSNAYGPVQTVAQSCRTGAATNVIFGLAVGYKSVIVPIFAIAGAIYASFRL
AAMYGIALAALGMLSTIATGLTIDAYGPISDNAGGIAEMAGMPRRVRERTDALDAAGNTT
AAIGKGFAIGSAALVSLALFGAYVSRAGIRTVNVVSPRVFVGLLAGAMLPYWFSAMTMRS
VGSAALRMVEEVRRQFDEIPGLAEGLAAPDYATCVRISTDASLREMVAPGALVMASPLVA
GTLFGVEALAGLLAGALVSGVQVAISASNSGGAWDNAKKYIEAGATEEARSLGPKGSEAH
KAAVIGDTIGDPLKDTSGPSLNILVKLMAVEALVFAPFFAAHGGIVFNHL*

5'UTR

chr05:3339723..3339817 (- strand) : 95 bp

CDS

chr05:3338886..3339722 (- strand) : 837 bp

chr05:3337226..3337605 (- strand) : 380 bp

chr05:3336739..3336825 (- strand) : 87 bp

chr05:3335633..3336641 (- strand) : 1009 bp

3'UTR

chr05:3335380..3335632 (- strand) : 253 bp

FASTA

>Os05t0156900-01 class=Sequence position=chr05:3335380..3339817 (- strand)
ACTCCACATC TCTTCTCCAT CAAGAATCAA TCACTCGCTC GTCTTCTCCT CCATTGGAGC TCTCGATCGA GCTTAGCTTT
GCGCTTCGTT CATCCATGGC GCTCATCGGC ACGGTGGCGG CCGAGGTGCT CATCCCGCTC GCGGCGGTGA TCGGCATCCT
CTTCGCCGTG CTCCAGTGGT ACATGGTGTC CAGGGTGGCC GTCCCGCCGC ACGACGGCGT Cggcggcgcc gggaaggtgg
agagggagag cgacggcggc gacggcgacg gcgacggcgt cgacgacgag gaggacggcg tggactaccg gggcgtggag
gcgaggtgcg cGGAGATCCA GCACGCCATC TCCGTGGGCG CGACGTCGTT CCTGATGACG GAGTACAAGT ACCTGGGCGC
GTTCATGGCG GCGTTCGCGG CGGTCATCTT CGTCTCGCTG GGCTCCGTGG GGCGGTTCTC CACGTCGACG GAGCCGTGCC
CGTACGACGC GGCGAGGCGG TGCCGCCCGG CGCTGGCGAA CGCGGCGTTC ACCGCGGCGG CGTTCCTCCT CGGCGCCACC
ACCTCGGTGG TCTCCGGCTA CCTCGGGATG CGGGTGGCGA CGTTCGCGAA CGCGAGGACG GCGCTGGAGG CTCGCCGCGG
GATCGGGCGG GCGTTCGCGG TGGCGTTCAG GTCGGGCGCC GCCATGGGGT TCCTGCTGGC GTCGAGCGCG CTGCTGGTGC
TGTTCGCCGC CGTGAACGCG TTCGGGCTCT ACTACGGCGA CGACTGGGGC GGGCTGTACG AGGCGATCAC CGGGTACGGG
CTCGGGGGGT CGTCCATGGC GCTGTTCGGC CGCGTCGGCG GCGGGATCTA CACCAAGGCG GCCGACGTCG GCGCCGACCT
CGTCGGCAAG GTGGAGCGCA ACATCCCCGA GGATGACCCC CGCAACCCCG CGGTAAGCCA CGCCACGTCA CTCTCCTCGT
CCTCACTCTG TTAAAGATTA AGTTAACACA CATAAAAATT AAGTTAACGC ACATGAAACG AGAAAGCTAT TAGCATATAA
TTAACTTTTC TTTAAGATAA AGGATTTAAA TAAAACCCGG CTTCTACATC CCGAAGAATG TACACAGCCA ACCAAATCCA
TACAAAAACA CTAAGGCTAG TAAAcatgat taactaagtt ttaattattg ctaactgata aattgatata tctgatagtt
taaagcaact tctgtataaa aagtttctgt aacgtatcgt ttagttgttt aaaaagcACG CTAATACGAA CAGAGGTAAT
ATCTGAATTT TAATCAGAAA AGAACATGAC CGAACCAATT CGATCTCATA TTTTAAAACA ACTCAAAGCT GCTTGCATGT
TGCATGCGAG CTCGGTTCGA TCTGAGCCAC TGCACTAATC TGAAAGCAAG TCCAGTTGGC CTTTTTTTGT TGCCTTCCTT
AAACATTACT AGGAAGCATG AAACTCACGT GTTCAGTGTT CTCTGCTAGC TGGCACAGGC GTAACGCATG ATTTTTACCG
GATTTATTCA TAGAAATATA GGAGAGAGAT TGAAAATTTA TTGTCTTGTT TGGAGAAAAG GAATTATTTA AAAAGTCTCG
CTAGGAAATA TTTAAATTGT GGACAAATTT AAACTGAATT TGACTTAGAA ATTTAAGTGA ATTCAATTCA AACCAACTTT
CTTTTTAAAA AGATCGATTG AAACAAATCT ATTTTGGCAG TTGATTTGTG TATGCATCCA CTTTGGATTG TTCTTTTGAC
TGAATAGCTC AATATCTGAA TATTTGTAAT GATTATTTGA GGTTACAAAC GAATGAACTA AATATTGTTT TCTTTTCGTT
TCGTATTATA AGATATTTTG GGTATAATTT GAATAGATTT ATGCATGAAT TCAGATACGT ACAATATGTA TATGTGCGCA
AATTTATATA GATATTAGTG AATTTAGATG ATGTATGAAG AGGCCAAAAC GTTGTATAAC ATATAACGGA GAAAATATAG
AGTTGAGATC GATTTTGGTT TGAAATAGTT TTCTCGAAAG AAATTATATA TACAAGAAGA TTTTATAAAA TGCTTTTATA
TAATTGTATC GTTTAAAAAA CCGTTTAAAA GTTTGGGAAG CTTACAAATT CACCCCCATC GTTCCCTTCC TTCAAAGAGA
AGTGATACAT CATATATGGT TTTGTACGTG CGTGTGGATA TGATGTGCGC AGGTGATCGC CGACAACGTG GGCGACAACG
TGGGCGACAT CGCCGGGATG GGGTCCGACC TGTTCGGGTC GTACGCGGAG TCGTCGTGCG CGGCGCTGTT CGTGGCGTCC
ATCTCCTCCT TCGGCGCCGA CCACGACTTC GCGGCGATGA TGTACCCGCT GCTGGTGAGC GCCGCCGGCA TCGTGGCCTG
CGCCGCCACC ACGCTCGTCG CCACCGACGC CGGCGAGCTC GGCGCCGCCG ACGAGGTCGC GCCCGCGCTC AAGCGCCAGA
TCCTCATCTC CACCGTGCTC ATGACCGCCG CCGTCGCCGC CGTCACCTTC CTCTCCCTCC CCCGCTCCTT CACCCTCTTC
GACTTCGGCG AACGCAAGCT CGTCAAAAAT TGGTAAAAGA AAAAAAAACC TTACATAGTG TGTAATTTAT TTTTTTTTGG
TTTTTTTAAA AAATTATAAT TACACGGCAG ACATACGCAC ACAAACAAGA CCACACTCAC ATCCCTGTAT ACAATACATT
TTTTTTAAAA GTTTTACAAT TACACGGGAG ACACACGTGC ACAGATAATA CCACACTCAC ATCCCTGTCT ATGTGCATTC
AACAACACAT TCTTGATTTC GGAGAAATCA TGTTAAAAAC CTAGTTACAG TGCGTAATAT TTATAAGCAC CAAGATTTGA
ATCTTGTTGG GTGGAGCCAT GCACCTATGA CTCTAGCAGT TGTACTTGCA CCAAATTTGA TTAAATTATG GAATAATAAT
AGTTTTGTCT GAATTTTTGT TGAATAATTC AGGCACCTGT TCATCTGCGT CTCAGCTGGT CTGTGGGCGG GATTGGTGAT
AGGCTACGTC ACCGAGTACT TCACGAGCAA TGCTTACGGG TGAAAACGAA TTCTACCCAC CCAAATTCGC GATGATTCTA
CATTTTGTAA AATTTCAAAT TTTGATGAAA TTTGCGTTCA AATTTCAAAT TGATAGGCCG GTGCAGACGG TGGCGCAGTC
GTGCCGGACG GGGGCGGCGA CGAACGTGAT CTTCGGCCTC GCCGTGGGGT ACAAGTCGGT GATCGTGCCG ATCTTCGCCA
TCGCCGGCGC CATCTACGCC AGCTTCCGGC TCGCCGCCAT GTACGGCATC GCGCTGGCTG CGCTGGGGAT GCTGAGCACC
ATCGCCACGG GGCTCACCAT CGACGCCTAT GGCCCCATCA GCGACAACGC CGGCGGCATC GCGGAGATGG CCGGCATGCC
GCGGCGCGTG CGCGAGCGCA CGGACGCGCT CGACGCCGCC GGGAACACGA CGGCGGCGAT CGGGAAGGGG TTCGCGATCG
GGTCGGCGGC GCTGGTGTCG CTGGCGCTGT TCGGCGCGTA CGTGAGCCGG GCGGGGATCC GGACGGTGAA CGTGGTGAGC
CCCAGGGTGT TCGTCGGGCT CCTCGCCGGC GCCATGCTCC CCTACTGGTT CTCGGCGATG ACGATGCGGA GCGTGGGGAG
CGCGGCGCTG CGGATGGTGG AGGAGGTGCG GCGCCAGTTC GACGAGATCC CGGGGCTCGC CGAGGGGCTC GCCGCGCCGG
ACTACGCCAC CTGCGTGAGG ATCTCCACCG ACGCGTCGCT GCGGGAGATG GTGGCGCCGG GGGCGCTGGT GATGGCGAGC
CCGCTCGTCG CCGGGACGCT GTTCGGGGTG GAGGCGCTGG CGGGGCTGCT CGCCGGCGCG CTGGTGTCCG GGGTGCAGGT
GGCGATCTCG GCGTCGAACA GCGGCGGCGC GTGGGACAAC GCCAAGAAGT ACATCGAGGC CGGGGCGACG GAGGAGGCGA
GGTCGCTGGG GCCCAAGGGC TCCGAGGCGC ACAAGGCGGC GGTGATCGGG GACACCATCG GCGACCCGCT CAAGGACACC
TCGGGGCCAT CGCTCAACAT CCTCGTCAAG CTCATGGCCG TCGAGGCGCT CGTCTTCGCC CCCTTCTTCG CCGCGCATGG
CGGCATCGTC TTCAACCACC TCTGATGAAG CTGAGCTCCA TTGCTAATAA ATTAAGCTGC ATGCATGCTC TCGCCATGAT
CGATCAGCTG CACCTGCATG CACGCATGGA TAAACAAGAA GAAGACGATG AGCATTAGGG TTCCTTAACC AGTTGAAACC
GATAAGAGTA ATAATTGTAG CTCGGGATAA TGCAGTGTCA GATGTAATCC AAAGTGTCTT GTTGCTTGGG ATATGTAATG
CGGTTTGAGA CTTAGGATGT AATCCAATGT TGTTTTAG

Locus: Os05g0156900

Loading...

Locus: Os05g0156900

Loading...