Os05t0158500-01

Locus

Os05g0158500

Description

Serine carboxypeptidase, Positive regulator of grain size

RAP-DB Gene Symbol Synonym(s)

GS5, OsSCP26

RAP-DB Gene Name Synonym(s)

GRAIN SIZE 5, serine carboxypeptidase 26

CGSNL Gene Symbol

GS5

CGSNL Gene Name

GRAIN SIZE 5

Oryzabase Gene Symbol Synonym(s)

OsSCP26, SCP26, OsGS5

Oryzabase Gene Name Synonym(s)

serine carboxypeptidase 26, Grain Size 5

Transcript Evidence

AK106800

Protein Evidence

Q5W727

Literature

PMID: 25711711

PMID: 22019783

PMID: 16895613

Note

Manual Curation

September 21, 2017

Gene Ontology (GO)

Biological Process: proteolysis (GO:0006508)

Molecular Function: serine-type carboxypeptidase activity (GO:0004185)

Functional domain (InterPro)

Alpha/Beta hydrolase fold (IPR029058)

Peptidase S10, serine carboxypeptidase (IPR001563)

Serine carboxypeptidase, serine active site (IPR018202)

Full-length cDNA

002-116-B10 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0158500-01)

RiceXPro (AK106800)

Others

Oryzabase (11971)

KEGG (Os05t0158500-01 (EC:3.4.16.-))

Transcript

1822 bp

>Os05t0158500-01 Serine carboxypeptidase, Positive regulator of grain size
AAGAACACCAAACGAGAAGCTCCAAGCTCGCAATAATTCACCAAGAATCGCACCACTTTT
CACCTTTTCTTCTCCTCCTCCATTTCCATCCATGGCGACGCTGCTGCTGCTGCTGCACAC
GGCGCAACAGTGAGCTATAGCTAGAGCTCGGCACCACGGGTTAGCAATGGCGGTGGCGGC
GGCGGCGGCGGCGAGGCGGCGAGATGTCTCTTGTCTTCTCCTCCTCCTGTGCTTCAGCTC
GTCAATGGCGGCGACCGGCGGCGGCGGCGGCGGCGGCGAGCAGGAGGCTGACAGGGTGGC
GCGGCTCCCGGGGCAGCCGGCGAGCCCCGCCGTGTCGCAGTTCGCCGGCTACGTCGGCGT
CGACGAGCGGCACGGCAGGGCGCTGTTCTACTGGTTCTTCGAGGCGCAGGCGTCGCCGGC
GCCGGAGAAGAAGCCGCTGCTCCTCTGGCTCAATGGAGGACCTGGTTGCTCTTCCATTGG
CTATGGTGCTGCATCAGAGCTAGGGCCTCTCAGAGTTGCAAGACAAGGAGCAGCACTAGA
GTTCAACCAGTATGGCTGGAACAAAGAGGCTAACCTCCTGTTCTTGGAGTCTCCTGTTGG
GGTCGGCTTCTCCTACACCAACACATCCTCTGACCTCTCCAATCTTAATGATGATTTTGT
AGCTGAGGATGCTTATAGTTTCCTGGTGAACTGGTTCAAGAGATTTCCTCAGTACAAGGA
CAATGAGTTCTACATCTCAGGGGAGAGCTATGCAGGTCACTATGTGCCCCAACTTGCTGA
CCTTGTCTATGAGAGGAACAAAGACAAAAGGGCCAGCACATATATCAACCTCAAGGGGTT
CATTGTAGGCAACCCTCTCACCGATGATTACTATGATTCAAAAGGTTTGGCTGAGTATGC
CTGGAGCCATGCAATTGTGTCGGATCAAGTTTACGAGCGCATCAAGAAAACTTGCAACTT
CAAGAACTCCAACTGGACTGACGATTGCAATGCTGCAATGAACATAATCTTCAGTCAGTA
CAATCAGATAGATATATACAACATTTATGCCCCAAAGTGCCTTCTAAACAGTACTTCAGC
ATCTTCACCTGATCGTGCATTCTTCGCAAATAACCAGGAACAATTCAGGTGGAGAATCAA
GATGTTTTCAGGCTATGATCCATGCTACTCATCCTATGCTGAGGACTACTTCAATAAGCA
TGATGTGCAAGAAGCATTCCATGCAAATGCCAGTGGACTGCTTCCAGGGAAGTGGCAAGT
TTGCAGTGACCAAATCCTCAACTCTTACAATTTCTCAGTACTTTCCATCCTACCTATATA
CTCCAAGCTCATCAAAGCAGGGCTGAGAGTTTGGCTCTACAGCGGTGATGCTGACGGCAG
GGTCCCGGTTATCAGTTCTCGGTACTGCGTGGAAGCACTCGGCCTACCGATCAAGACCGA
TTGGCAATCTTGGTACCTTGACAAGCAGGTTGCTGGGAGGTTTGTGGAGTACCATGGAAT
GACAATGGTGACTGTCAGAGGGGCAGGTCACCTGGTTCCCCTCAACAAACCTGCTGAAGG
GCTTATGCTGATAAATGCATTCCTTCATGGTGAGAAGCTTCCGACAAGCAGATGATATGC
GCTGCTGATGAAGCTTTGGAGGTACAAGATGGCATGAGATACAGGCATGGACATCAATTT
TCATTGAAAGGCGCCAATCGGATAGATTTGATATGGTAGTATCCAAATCAATTTCAAGTG
CGCCGTAAATTCAGTACTCTGTTGAACATTCTTTTAAATCTGTTGTTGACTATGACTTTC
TTCTTTTGTGTTTTTTTtactc

CDS

1449 bp

>Os05t0158500-01 Serine carboxypeptidase, Positive regulator of grain size
ATGGCGGTGGCGGCGGCGGCGGCGGCGAGGCGGCGAGATGTCTCTTGTCTTCTCCTCCTC
CTGTGCTTCAGCTCGTCAATGGCGGCGACCGGCGGCGGCGGCGGCGGCGGCGAGCAGGAG
GCTGACAGGGTGGCGCGGCTCCCGGGGCAGCCGGCGAGCCCCGCCGTGTCGCAGTTCGCC
GGCTACGTCGGCGTCGACGAGCGGCACGGCAGGGCGCTGTTCTACTGGTTCTTCGAGGCG
CAGGCGTCGCCGGCGCCGGAGAAGAAGCCGCTGCTCCTCTGGCTCAATGGAGGACCTGGT
TGCTCTTCCATTGGCTATGGTGCTGCATCAGAGCTAGGGCCTCTCAGAGTTGCAAGACAA
GGAGCAGCACTAGAGTTCAACCAGTATGGCTGGAACAAAGAGGCTAACCTCCTGTTCTTG
GAGTCTCCTGTTGGGGTCGGCTTCTCCTACACCAACACATCCTCTGACCTCTCCAATCTT
AATGATGATTTTGTAGCTGAGGATGCTTATAGTTTCCTGGTGAACTGGTTCAAGAGATTT
CCTCAGTACAAGGACAATGAGTTCTACATCTCAGGGGAGAGCTATGCAGGTCACTATGTG
CCCCAACTTGCTGACCTTGTCTATGAGAGGAACAAAGACAAAAGGGCCAGCACATATATC
AACCTCAAGGGGTTCATTGTAGGCAACCCTCTCACCGATGATTACTATGATTCAAAAGGT
TTGGCTGAGTATGCCTGGAGCCATGCAATTGTGTCGGATCAAGTTTACGAGCGCATCAAG
AAAACTTGCAACTTCAAGAACTCCAACTGGACTGACGATTGCAATGCTGCAATGAACATA
ATCTTCAGTCAGTACAATCAGATAGATATATACAACATTTATGCCCCAAAGTGCCTTCTA
AACAGTACTTCAGCATCTTCACCTGATCGTGCATTCTTCGCAAATAACCAGGAACAATTC
AGGTGGAGAATCAAGATGTTTTCAGGCTATGATCCATGCTACTCATCCTATGCTGAGGAC
TACTTCAATAAGCATGATGTGCAAGAAGCATTCCATGCAAATGCCAGTGGACTGCTTCCA
GGGAAGTGGCAAGTTTGCAGTGACCAAATCCTCAACTCTTACAATTTCTCAGTACTTTCC
ATCCTACCTATATACTCCAAGCTCATCAAAGCAGGGCTGAGAGTTTGGCTCTACAGCGGT
GATGCTGACGGCAGGGTCCCGGTTATCAGTTCTCGGTACTGCGTGGAAGCACTCGGCCTA
CCGATCAAGACCGATTGGCAATCTTGGTACCTTGACAAGCAGGTTGCTGGGAGGTTTGTG
GAGTACCATGGAATGACAATGGTGACTGTCAGAGGGGCAGGTCACCTGGTTCCCCTCAAC
AAACCTGCTGAAGGGCTTATGCTGATAAATGCATTCCTTCATGGTGAGAAGCTTCCGACA
AGCAGATGA

Protein

483 aa

>Os05t0158500-01 Serine carboxypeptidase, Positive regulator of grain size
MAVAAAAAARRRDVSCLLLLLCFSSSMAATGGGGGGGEQEADRVARLPGQPASPAVSQFA
GYVGVDERHGRALFYWFFEAQASPAPEKKPLLLWLNGGPGCSSIGYGAASELGPLRVARQ
GAALEFNQYGWNKEANLLFLESPVGVGFSYTNTSSDLSNLNDDFVAEDAYSFLVNWFKRF
PQYKDNEFYISGESYAGHYVPQLADLVYERNKDKRASTYINLKGFIVGNPLTDDYYDSKG
LAEYAWSHAIVSDQVYERIKKTCNFKNSNWTDDCNAAMNIIFSQYNQIDIYNIYAPKCLL
NSTSASSPDRAFFANNQEQFRWRIKMFSGYDPCYSSYAEDYFNKHDVQEAFHANASGLLP
GKWQVCSDQILNSYNFSVLSILPIYSKLIKAGLRVWLYSGDADGRVPVISSRYCVEALGL
PIKTDWQSWYLDKQVAGRFVEYHGMTMVTVRGAGHLVPLNKPAEGLMLINAFLHGEKLPT
SR*

5'UTR

chr05:3443604..3443769 (- strand) : 166 bp

CDS

chr05:3443312..3443603 (- strand) : 292 bp

chr05:3442765..3442872 (- strand) : 108 bp

chr05:3442538..3442633 (- strand) : 96 bp

chr05:3442318..3442410 (- strand) : 93 bp

chr05:3441290..3441378 (- strand) : 89 bp

chr05:3440515..3440787 (- strand) : 273 bp

chr05:3440281..3440429 (- strand) : 149 bp

chr05:3440085..3440180 (- strand) : 96 bp

chr05:3439752..3439857 (- strand) : 106 bp

chr05:3439511..3439657 (- strand) : 147 bp

3'UTR

chr05:3439304..3439510 (- strand) : 207 bp

FASTA

>Os05t0158500-01 class=Sequence position=chr05:3439304..3443769 (- strand)
AAGAACACCA AACGAGAAGC TCCAAGCTCG CAATAATTCA CCAAGAATCG CACCACTTTT CACCTTTTCT TCTCCTCCTC
CATTTCCATC CATGGCGACG CTGCTGCTGC TGCTGCACAC GGCGCAACAG TGAGCTATAG CTAGAGCTCG GCACCACGGG
TTAGCAATGG CGGTGGCGGC GGCGGCGGCG GCGAGGCGGC GAGATGTCTC TTGTCTTCTC CTCCTCCTGT GCTTCAGCTC
GTCAATGGCG GCGACCGGCG GCGGCGGCGG CGGCGGCGAG CAGGAGGCTG ACAGGGTGGC GCGGCTCCCG GGGCAGCCGG
CGAGCCCCGC CGTGTCGCAG TTCGCCGGCT ACGTCGGCGT CGACGAGCGG CACGGCAGGG CGCTGTTCTA CTGGTTCTTC
GAGGCGCAGG CGTCGCCGGC GCCGGAGAAG AAGCCGCTGC TCCTCTGGCT CAATGGAGGT CTCGATCGCT TCTGCTTTTT
TTTTTTCTAA AAAAAAAGAA TTTGCTGCAG TAAAAGCTCT GTTAAATGTT AATCGGTTAA AAATTCTGTT AGTTAAGTAA
GTAATTACTC CTAGTAAAAA CTACAGTTTC TGTTTGTTCT TTTGTGTGTG CGATATGAAA AATTCAGATA TTTTCTCTTG
GGTATTTGTT CTGTGGAGTA CTTGTCGTTT ATGTTTGTTT AGTTTTGAGA TGAGGTTTCA GGTTAAATTT GTGATCATTG
GTTAATCTGA ACTTCTGAAG AGCTGCTTAT TGATTTTTTT TCTTTCAACT GATCATATTG CATAAATATA AATAAATAAA
TGATTGTTGC ATGCAACATT TATGTTCTTT CTTGATGGTT AATTAGGAAT ATTTTTTTTT CTAAATGGTT TGTTAATTTT
GTTCTTGGTT TTGTCAGGAC CTGGTTGCTC TTCCATTGGC TATGGTGCTG CATCAGAGCT AGGGCCTCTC AGAGTTGCAA
GACAAGGAGC AGCACTAGAG TTCAACCAGT ATGGCTGGAA CAAAGGTGCA GAGTTTATTT TGTTTCCTTT AATTCCTGAA
TTATTTAAAT ATTTTTCATG CTTAACATCA CTGACATTTG TCTTTAGTAT AATTCTGAAA ACATTTTTTT TGTGCTATAA
AATTGGTCTT TGCCAGAGGC TAACCTCCTG TTCTTGGAGT CTCCTGTTGG GGTCGGCTTC TCCTACACCA ACACATCCTC
TGACCTCTCC AATCTTAATG ATGATTTTGT AGGTAATTAA GCTGATTGTA AAATGATACT CTAGTTTGCT TGGCCATCTA
CAGGTGATCT GAATTTCGAT TGCCTTGTAA TAATGATTAG AAGTGTAATT TTGTGGCATC CTTTTTTTTT TTGTTGCAGC
TGAGGATGCT TATAGTTTCC TGGTGAACTG GTTCAAGAGA TTTCCTCAGT ACAAGGACAA TGAGTTCTAC ATCTCAGGGG
AGAGCTATGC AGGTAAACTC ATTTCAGAAA TGAAACCGGT AAATTTTCTA ATCAGTTTTG TATGGTCTAA CATTCAGAAT
TCTTCATTTT CATCAAGAAA TTAAAAGATT TCCTAACCGC AACATATTAC AAAATCTGGT GTGAGACATT TTTCTCATTT
GTTCTCATGT GGATGTAAAC ATGTCCAAGA TGCCTTCCTT TCAAGATTCC AGTTATCTAA TCAAAATGGA AGGCAGCATC
CCAATCCTTG ACCAAAATTT TCTTATCGTT TGCTTTCACA ATATCTCAAG GATTGTATGT ATCGAATTAT GTTAGTGTCA
CCATCTTATC TGAAACCAGA ACTTCCACTG AAGAAAAAAA TCATCACTGA CTTTATAGAA CTAGCTGACA CCTATCATGA
GTTCATGACA GCTCTTAGTT CAGCAATCAT CCCCTTAGCA AGCAAACAAA AGATCATACT TTTAATGGTG AAAGTGTCAG
ATCAGGAACC AAGTCTCTAA AATAATATAA GGTTTAGTTT CAGCCTTCTC AAATATTCCT GAAGTACAAT ATTCTCAGAG
TCATCTGATT GTTCAGAATT CAGAAGAAAT TTATGTAGAA TTCAGTAAAA GATGACCTGC TTAAACAAAA GGTAGAATGA
TTTCAGTTGT TACTTGCATT TATGTATTGA GGACAGAAAT TATACCGATG CCATCCGAAC TGATAGATTT TCTCTGCTTG
AAACAAAGTT TGAGTTTTTG GATTGTAATA TTGGTCCATT AGATCTCTGA ACATATGTCC CTGAAAGAAT GACCAAAGCA
TCAGTGGTAG GTTCACGGGC TACATTGGGC TTCTTTCACA ATCCACATGC TGTGGACCAG AAGATGCTCT GCAAAAAAAG
CTTTTGTTCT GCACATCATG CAAGATGAAT CTCAATCTGA ACTTTTCCTG TGCAATGTCC CTGTTATACA GGTCACTATG
TGCCCCAACT TGCTGACCTT GTCTATGAGA GGAACAAAGA CAAAAGGGCC AGCACATATA TCAACCTCAA GGGGTTCATT
GTGAGAATTT CTTGAATTGC TTTCAGTAAT TATTGTTATG GTTTTGCCAA AAAGTTCTTT TATGTGAAAT GTGCTCATGT
ATAAGAAACC ATATACAAAC TTAGAAAGTA GAAAGAACTG tttactctca ccgtttcata ttgcttgtca ttttagcttt
gtcttaagtc aaacattcct tacaacttac gccataaact tttactcata agatttatgt ttttagattg aacaaaagaa
atactttcat aatatataat tcacatgttc ttaaactata tgaatttaca gaaattgatg gtcaaagtta ggtatattcg
acttaggaca aaactaaaac gacaagtaat ttgaaacgga gggagtaTTT TGAACAATAG TTTCTCAGTT GTAATGCTCA
CAGGAACACC CAATTGGAAC ACGATTAACT TCCATTTAAA CCATCCTAAA CTCATAAAAT TGGTTCCTGC ATGAACATAA
CAGTCAAAAA ATCTGCTTGC AGGTAGGCAA CCCTCTCACC GATGATTACT ATGATTCAAA AGGTTTGGCT GAGTATGCCT
GGAGCCATGC AATTGTGTCG GATCAAGTTT ACGAGCGCAT CAAGAAAACT TGCAACTTCA AGAACTCCAA CTGGACTGAC
GATTGCAATG CTGCAATGAA CATAATCTTC AGTCAGTACA ATCAGATAGA TATATACAAC ATTTATGCCC CAAAGTGCCT
TCTAAACAGT ACTTCAGCAT CTTCACCTGA TCGTGCATTC TTCGCAAATA ACCAGGTAAA ACTGATCCAT ATGCAAAAAA
AAGGATAAAG TTTCATTCTG GACCCTCTTC TGAAATTCAT GCATTTCTGT GTTTTGACAG GAACAATTCA GGTGGAGAAT
CAAGATGTTT TCAGGCTATG ATCCATGCTA CTCATCCTAT GCTGAGGACT ACTTCAATAA GCATGATGTG CAAGAAGCAT
TCCATGCAAA TGCCAGTGGA CTGCTTCCAG GGAAGTGGCA AGTTTGCAGG TGAATTAGCC CAAAGATTTT TCAGTTTTAT
ATTTCAATGT ATTAGCCATT AATTCTTTTA GCTTGACAGG AAGCTGAGCT CATCCATTTC TTTTTGCAGT GACCAAATCC
TCAACTCTTA CAATTTCTCA GTACTTTCCA TCCTACCTAT ATACTCCAAG CTCATCAAAG CAGGGCTGAG AGTTTGGCTC
TACAGGTTTG CCTCATCTTA ATCTTAGACC TGTTCAATTA AATCCATTTT TCAGTTTTTT TTATCATTCA CCTCAGATCT
TCCCCATTAT CCTCCATACT ACAGTTCTTG TACAGTTTCT CTGAAACCTT GAAATTACTG TTCAAATATA TTGGTAGTAA
TATGCATCTA CATAAAAAAT ATGCAACAAT GCCCTACAAT TTACCTGAAT CAGTCTCTGT TCATCAAAGC AGCGGTGATG
CTGACGGCAG GGTCCCGGTT ATCAGTTCTC GGTACTGCGT GGAAGCACTC GGCCTACCGA TCAAGACCGA TTGGCAATCT
TGGTACCTTG ACAAGCAGGT CTGCAAACCA GAAGCTGAAC TGAACATCAA TACATCATGT GATTTGACTT GTATACATGC
TGAAACATGG AGCAAAATAT TTCAATTTGC AGGTTGCTGG GAGGTTTGTG GAGTACCATG GAATGACAAT GGTGACTGTC
AGAGGGGCAG GTCACCTGGT TCCCCTCAAC AAACCTGCTG AAGGGCTTAT GCTGATAAAT GCATTCCTTC ATGGTGAGAA
GCTTCCGACA AGCAGATGAT ATGCGCTGCT GATGAAGCTT TGGAGGTACA AGATGGCATG AGATACAGGC ATGGACATCA
ATTTTCATTG AAAGGCGCCA ATCGGATAGA TTTGATATGG TAGTATCCAA ATCAATTTCA AGTGCGCCGT AAATTCAGTA
CTCTGTTGAA CATTCTTTTA AATCTGTTGT TGACTATGAC TTTCTTCTTT TGTGTTTTTT Ttactc