Os05t0158600-01

Locus

Os05g0158600

Description

Similar to OsGA2ox1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GA2OX1

CGSNL Gene Name

GIBBERELLIN 2-OXIDASE 1

Oryzabase Gene Symbol Synonym(s)

OsGA2ox1, ga2ox-1, OsGA2ox-1, ga2ox, ga2ox 1, GA2ox1

Oryzabase Gene Name Synonym(s)

rice GA 2-oxidase1, GA 2-oxidase 1, Gibberellin 2-oxidase 1

Transcript Evidence

AK120967 (DDBJ, Best hit)

Protein Evidence

Q9AVA5 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

J023040G12 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0158600-01)

RiceXPro (AK120967)

Others

Oryzabase (5114)

KEGG (Os05t0158600-01)

Transcript

5897 bp

>Os05t0158600-01 Similar to OsGA2ox1.
TCGCAGCCAACTCCAACATCCTGAGCTCCAATCTCCCACTCCATTCCGGCCGCGCATTCT
CCCGCTCTCGATCGATCGATCGATCATGGTGGTGCCTTCCGCGACGACGCCAGCGAGGCA
GGAGACGGTGGTGGCGGCGGCGCCGCCAGCTGCGGCGGCGTCCGGTGTCGTCGGCGGCGG
CGGCGGCGTGACGATAGCGACGGTGGACATGTCGGCGGAGCGCGGCGCGGTGGCGAGGCA
GGTGGCGACGGCGTGCGCGGCGCACGGGTTCTTCCGGTGCGTCGGGCACGGCGTGCCGGC
GGCGGCGCCCGTCGCGGCGAGGCTGGACGCCGCGACGGCGGCGTTCTTCGCGATGGCGCC
GGCGGAGAAGCAGCGCGCCGGGCCGGCGAGCCCGCTCGGGTACGGCTGCCGGAGCATCGG
GTTCAACGGCGACGTCGGCGAGCTGGAGTACCTGCTCCTCCACGCCAACCCCGCCGCCGT
CGCGCACCGGGCCAGGACCATCGACGCCATGGACCCCTCTCGCTTCAGGTACGTACAATA
CCACCACTCACTCTTAGCCTAGCTTAATCGATTAGTTTTTTACTCCCTCCATTTCTCCGT
TTCCCCGTTTCATGTTATAAGATGTTATGGGTTTTTGAATATATAGATTCACGTTTCACG
CTATAAAATGTTCTGGGTTTTGAATAAATTCATGCATGATCTATTGATGAACTTTTAAGA
GTCCAAAACATTTTGTAACATGGAACGGATGGAGTGGCGTATTGTGTTGCGCCTACGTGT
CAAAGTATGCATGCTTACATGGCACACGTATTTAAAACATTGTTATGCATGTATATAACT
AATGTTCTCTATGGTTTAATTTTTTCTTAATGCTACCCATGCATATTCTATAATAAATAA
AGTGTGCCGGACTCCGGTCACAGAAGAATATATTTGTTTTAATGTATCAGTTTAACTTCG
ACGATAATTATTATTGTTCGAAGTACAAATTTTCGGCATATTTAATAGTGTGGCCTTGTT
CTATCAAAACATAATTTTTCGTAAGAGATTATATACTTGTATAACTTATTTTTGGATTGT
AGGGATCCTTTCCCTATGGTTTTACTTCAAAAGATGACTTACATTTGGATTGGTGATAAA
GAATATACAACTAAGTAGACAAAGTTATATCTAGTTCATTTTGAAAAGTTCAAGGCTCTT
TTTTCAACGGGAAAGGAGTATCCTATATAAGATATATTATACAGTTAACTCTGTGCCTTT
TAAAAGCTCTGTTGACAGTAAAATCTCATGTAGCTGGTTCATCCAAAAAAAAAATTCTCA
TGTAGCTGGGCATACACGAGCTTTTTTTTTTTTTAAGAACTTACATACACGAGCTTAATT
ACTTCTCTCGATCCTTTTGCGGATGCGCTTGGTTGCTCGTAATAAATTTTGTCACAAATC
TTTGATAACCCCACCATTTCCCAAATTTAAGCATACATGGTGGTAGAACTATATTCACTA
AGTTTTACAGTGTCGTTGTTACAACAATAAACTAATATTGCAAATATTGCAATAGTTACA
ATATAATTAATTTCTTCTATGTATTATGTACTGAAACGCATATCAATCACATGCATGGCA
CTGCATATATGGTCTTAAACTATATATGAGGCAACGTGAATAATATATATTATTAATTAA
GTATTACCCGTATACACACACATACACATATAATTAAAGATTGTCATTTTTATTATTTTT
GCTAGACCCCTCGTCCCTGTGCATCACTAAAGTATTTTTATTGAACTAGCTGACCTCTAC
AGGGGTTTAAAGCTTGATTACTTAATTAAACTGTTAATGAAAGACGACTATATATGATCC
AATAATATGTTAATTAAGACGGTGCATGGGTGTCCGGTGTCCCTGCAGTGTGAGATGAAC
ATGCAAAAAAAATTAAATATATATCATGCTGTGTTCCTTAACTAACCGGCCACATCTACA
TATTCATGTCATAATCCTGCATCTGTCTCACTGCTGATGTGATGCCGTCCAAGCAGTAGT
AGTGTGGGTTGGTAGCAGTAAAAGGGTTTTGTCAGCTTGGTTAGGTTTTCCTATCTACAA
TATATCTATCTATCTTTTTCATGTGTTGTCAAAATACAGTGAGATATGCTTACATATTTC
TGCATCTGAGTACTGCTCAGGGGTGATGCAACGAAGCATCAGGTACATATCTATATATTT
AGAGGGCTCAGGGCTCCATCGTTTAGCCTTCAGTTTACAGGCATAAGAAAAAATAAATTT
TATAGTTAATTTTTAGGTTTTTTTTATCGTAATTTATTTTTTCAGTATTTACTAAGAACA
TGTGTATAAAAGTTTTATCTATATATTATTTTTTAATCACTAATATACTGTTTCGCTTAT
AACTATATAGTAGTATAAGGTATAGACTTGCATGATGTCTATCTACATGCATGCATGGGA
TGCATATGTAGGATAGGCTTGGCTTGAGAGATGTCTAGCTAGCTATGGGTTTTTCATCAG
CTACAGGGCAATTAATTTATAGATATGCATAATATATTGTGTTCAGAAGTCAAAAGAAGG
CCAAGTTGGAATCATGCATACCTGCACTGCACTCATGCCAGTTGCAAGCTTGCAATTGCA
ACTGGGCTTGCTTCTTTTCTTTTCAGCTGGTTTGGCTTGCATATTTTCCATGTTATGATC
TTCTGATGTAGCCTTTTGACTATATATCAAGGATGGACTAAATGTTAGTTTACACAATAA
GGAAAAGGATGGAAATGTTACACTCATGTCATCATATACTATAACTTAAGGTAAATTAAG
ATCAATTTACATTAATTTTATTAAGAAAAAGTTGACTCAAGAAAGCTGCAGTTTATGTTA
TAATTTTAACTTATTATGTTAGCATATGGGGTTTTCATTTTTAATTCTTCATAGTACTAC
TTCAGTACATATCCATATGTATACTGTCATTTTCAGACACAGGTCCCATCAATTAAATCA
CGGAAATGCATGAGTACATAGTTTTCAAAACAATAATTATCACAATAATGGCATAATTGA
TGCTATGATGGACAGGCCAATGATAAGTTAGTTCCAACAATTTAAGATCATACATAGCTA
GTTTCTAAAGCAAAAGAAAAGCATGCAACTGATGGGACATAACAAACTTGATAGCTCCAC
AAAATGGGCATAAGAAATTTTCTGATGAAAGTTAGGTATCATTGTCTAACCAAATAGACA
TTGGAAAAGGATCAAGCATACCAATTGATATTTTCATTTTTGCTCTAAAAAATGACTACA
TAAGTGGTTTTGAAAGCGAAAGCGAATATTGCCATTGGAGAAAATGTCTACCAACTAAGA
CAATAATATATCAGATTTTCCTTAACTATCTTTGTGTATGCTGAATGAGAGCTCACATAC
TAGGAGAGATTACTCACCACTCACTGACTGTACTCAGAACCAGGTAGTGGCCTAATCAGA
GTTTGCTGAGAGAAAATATGATGAAATGGACAAGAAAACCCTCACTTAGGTAGTTAGAAG
ACTCCTCTCAGGGTCCCTCTCCAACAAACTGTATATATTTGTGTATCAACCAATCTGACA
TATATGCAGTGGTTTCCAATTAATGGCAATATCCAACCACCAACTGATGCAGCAACAGAG
TGAGTACTTGAAGCATCCTTATCTACCAGAAAGCTCTGCAAGCTTAATTAGCAAAGTACA
GCAGGTTTTCatgtagaaaatgatgtgtttagttgggatatacatgatatatactttttg
aaactcctcttagttctctatcaccatacatacatcagccattaatatataatatccata
ctagtacaagaatattaatcTTAATGCCTTAATCAACTCAAAAGCCTAAGCTTAATTATC
ACAAGCACATCATTTTGGAAACATATTGATAGCAACATGCCAGTGAAGTAGTGAACACAA
AGAATGGGATAATAATGATCAAGAATGCATCAGGTTAAGAACAGAATGGCTAGGAAATCT
TCACAGTAACCATTTTGCTATATGAAAAGTGCAAGACAAGAAGGAAGAACAACCTCTTTT
TGTCAAATGCAACAGACAGGGGCCCACATGGAAGTACACACATGTCTGATGAGAATAAAA
TGATCCAGGCCCCTAAAGAGCATATCTATGCTATCCATATAAAGCCAAACAAAAGAAAGG
AGGCACACATGCAAGGAGTCCTCTTTATGGTAAGATAAAATGAAATGTCCCAGAGGTTGT
GTAGTGGCAGGGGCAGTGATACTTGTGATCCACGCACTGATGGGTCTTTCCATGGAGCAG
TGGAAAAAAGTATGGCCAATCCTGTCAACAACACATTTTTGCCCATTGGAAAATTTGTCA
CCCCTCGGCTGCATGATGTACTGCTGATTCTGTGGCCTATCCATGCATCACAAGATTCAC
AAGAAACGAATATATCACGTCTTGTAGATGGTGGTGCACAAGCACAGAGGCATACACATA
TACCCATCAGTGTATCATCTTTTCTAACTCATCAGGCAGGCATGCCGAGGGAGGGTGGGT
GCAGCTTTTGATTTGCTGCAGCCATCAATCAGTCAAAGACCTTGCTCCTCTTTCTCCAGC
TTCTTTTTACTTGTCATGGCACATCCAACCTGATTCTGTGATAACAGCATTCTTTTGATA
AAATCAATTTCAAGTTGATTGTGCTCACTTGCTGATATCCTCCCTCACTCTGTTGCAGTG
CTATTGTGAATGAGTACATTGAAGCCATGAAGAAGCTCGCATGTGAGATCCTGGACCTGT
TAGGAGAGGGGCTAGGTCTCAAGGACCCCAGATACTTCAGCAAGCTTACCACAAACGCTG
ACAGTGACTGCCTCCTGAGGATCAACCACTACCCTCCATCATGCAACATTCACAAACTTG
ACCATGATGACCAATGCAATATCAAGAGCCTTGTTAGCACCAAGGCTAGCAATGGTGGGA
ATCTGATGGCAGGTGGGCGCATTGGGTTCGGCGAGCACTCTGACCCGCAGATCCTTAGCT
TGCTCCGAGCAAACGATGTGGAAGGGCTACAGGTGTTTGTGCCGGACCACGAGGGCAAGG
AGATGTGGGTTCAGGTGCCATCGGACCCATCGGCCATTTTCGTCAATGTTGGTGATGTCC
TCCAGGCTCTGACAAATGGGAGGCTGATAAGTATCCGGCACAGGGTAATTGCAACCGCCT
GCAGGCCAAGGCTGTCCACAATATACTTCGCATCACCACCCCTGCATGCACGAATCTCGG
CACTCCCAGAGACAATCACAGCCAGCAGCCCACGCCGATACCGATCATTCACCTGGGCTG
AGTACAAGACGACAATGTACTCACTCCGCCTGAGCCACAGCCGCCTAGAACTCTTCAAAA
TTGACGATGATGACAGCGACAATGCCAGTGAGGGAAAAGCATAGGAATTGCTGGTTAAAT
TGCAGACGATGCCTATGGACCAGTGGGGATTAGGAAGCTGAAACTGTCCCCAAAATTTTG
GCTCTCTGGCAGTCTGGCTACTATCGTCAGATATCTCACTATTATGATGGTGTAGTGCCT
AAGTTGACGGGTGTGTAATATCGTTAGCAGTCTACAGAAGCTATGGTTGTACGGAAGTAA
TGTACTGTCGCCTTTTCAGCTAACTATCCATGTTCTCTCTTATATGTAATGAGTTAGTTG
ACGGATGTGTAATATTGCTAGCATTGTATATAAGCTATGGTTGTATGGAAGTATGTAATA
TAGCCTTTTCAGCTAACTATCCGTGTTCCCTTTGTCCCTCTAAAGCACAAAAGTAAGACC
TAACTACAGAGCACAATAGATAGTTTTTGAGAACTATGATCTATTAAGAAATCTTAAGAG
AAATCAGAATACTTTTG

CDS

477 bp

>Os05t0158600-01 Similar to OsGA2ox1.
ATGGTGGTGCCTTCCGCGACGACGCCAGCGAGGCAGGAGACGGTGGTGGCGGCGGCGCCG
CCAGCTGCGGCGGCGTCCGGTGTCGTCGGCGGCGGCGGCGGCGTGACGATAGCGACGGTG
GACATGTCGGCGGAGCGCGGCGCGGTGGCGAGGCAGGTGGCGACGGCGTGCGCGGCGCAC
GGGTTCTTCCGGTGCGTCGGGCACGGCGTGCCGGCGGCGGCGCCCGTCGCGGCGAGGCTG
GACGCCGCGACGGCGGCGTTCTTCGCGATGGCGCCGGCGGAGAAGCAGCGCGCCGGGCCG
GCGAGCCCGCTCGGGTACGGCTGCCGGAGCATCGGGTTCAACGGCGACGTCGGCGAGCTG
GAGTACCTGCTCCTCCACGCCAACCCCGCCGCCGTCGCGCACCGGGCCAGGACCATCGAC
GCCATGGACCCCTCTCGCTTCAGGTACGTACAATACCACCACTCACTCTTAGCCTAG

Protein

158 aa

>Os05t0158600-01 Similar to OsGA2ox1.
MVVPSATTPARQETVVAAAPPAAAASGVVGGGGGVTIATVDMSAERGAVARQVATACAAH
GFFRCVGHGVPAAAPVAARLDAATAAFFAMAPAEKQRAGPASPLGYGCRSIGFNGDVGEL
EYLLLHANPAAVAHRARTIDAMDPSRFRYVQYHHSLLA*

5'UTR

chr05:3459576..3459660 (+ strand) : 85 bp

CDS

chr05:3459661..3460137 (+ strand) : 477 bp

3'UTR

chr05:3460138..3464740 (+ strand) : 4603 bp

chr05:3465258..3465989 (+ strand) : 732 bp

FASTA

>Os05t0158600-01 class=Sequence position=chr05:3459576..3465989 (+ strand)
TCGCAGCCAA CTCCAACATC CTGAGCTCCA ATCTCCCACT CCATTCCGGC CGCGCATTCT CCCGCTCTCG ATCGATCGAT
CGATCATGGT GGTGCCTTCC GCGACGACGC CAGCGAGGCA GGAGACGGTG GTGGCGGCGG CGCCGCCAGC TGCGGCGGCG
TCCGGTGTCG TCGGCGGCGG CGGCGGCGTG ACGATAGCGA CGGTGGACAT GTCGGCGGAG CGCGGCGCGG TGGCGAGGCA
GGTGGCGACG GCGTGCGCGG CGCACGGGTT CTTCCGGTGC GTCGGGCACG GCGTGCCGGC GGCGGCGCCC GTCGCGGCGA
GGCTGGACGC CGCGACGGCG GCGTTCTTCG CGATGGCGCC GGCGGAGAAG CAGCGCGCCG GGCCGGCGAG CCCGCTCGGG
TACGGCTGCC GGAGCATCGG GTTCAACGGC GACGTCGGCG AGCTGGAGTA CCTGCTCCTC CACGCCAACC CCGCCGCCGT
CGCGCACCGG GCCAGGACCA TCGACGCCAT GGACCCCTCT CGCTTCAGGT ACGTACAATA CCACCACTCA CTCTTAGCCT
AGCTTAATCG ATTAGTTTTT TACTCCCTCC ATTTCTCCGT TTCCCCGTTT CATGTTATAA GATGTTATGG GTTTTTGAAT
ATATAGATTC ACGTTTCACG CTATAAAATG TTCTGGGTTT TGAATAAATT CATGCATGAT CTATTGATGA ACTTTTAAGA
GTCCAAAACA TTTTGTAACA TGGAACGGAT GGAGTGGCGT ATTGTGTTGC GCCTACGTGT CAAAGTATGC ATGCTTACAT
GGCACACGTA TTTAAAACAT TGTTATGCAT GTATATAACT AATGTTCTCT ATGGTTTAAT TTTTTCTTAA TGCTACCCAT
GCATATTCTA TAATAAATAA AGTGTGCCGG ACTCCGGTCA CAGAAGAATA TATTTGTTTT AATGTATCAG TTTAACTTCG
ACGATAATTA TTATTGTTCG AAGTACAAAT TTTCGGCATA TTTAATAGTG TGGCCTTGTT CTATCAAAAC ATAATTTTTC
GTAAGAGATT ATATACTTGT ATAACTTATT TTTGGATTGT AGGGATCCTT TCCCTATGGT TTTACTTCAA AAGATGACTT
ACATTTGGAT TGGTGATAAA GAATATACAA CTAAGTAGAC AAAGTTATAT CTAGTTCATT TTGAAAAGTT CAAGGCTCTT
TTTTCAACGG GAAAGGAGTA TCCTATATAA GATATATTAT ACAGTTAACT CTGTGCCTTT TAAAAGCTCT GTTGACAGTA
AAATCTCATG TAGCTGGTTC ATCCAAAAAA AAAATTCTCA TGTAGCTGGG CATACACGAG CTTTTTTTTT TTTTAAGAAC
TTACATACAC GAGCTTAATT ACTTCTCTCG ATCCTTTTGC GGATGCGCTT GGTTGCTCGT AATAAATTTT GTCACAAATC
TTTGATAACC CCACCATTTC CCAAATTTAA GCATACATGG TGGTAGAACT ATATTCACTA AGTTTTACAG TGTCGTTGTT
ACAACAATAA ACTAATATTG CAAATATTGC AATAGTTACA ATATAATTAA TTTCTTCTAT GTATTATGTA CTGAAACGCA
TATCAATCAC ATGCATGGCA CTGCATATAT GGTCTTAAAC TATATATGAG GCAACGTGAA TAATATATAT TATTAATTAA
GTATTACCCG TATACACACA CATACACATA TAATTAAAGA TTGTCATTTT TATTATTTTT GCTAGACCCC TCGTCCCTGT
GCATCACTAA AGTATTTTTA TTGAACTAGC TGACCTCTAC AGGGGTTTAA AGCTTGATTA CTTAATTAAA CTGTTAATGA
AAGACGACTA TATATGATCC AATAATATGT TAATTAAGAC GGTGCATGGG TGTCCGGTGT CCCTGCAGTG TGAGATGAAC
ATGCAAAAAA AATTAAATAT ATATCATGCT GTGTTCCTTA ACTAACCGGC CACATCTACA TATTCATGTC ATAATCCTGC
ATCTGTCTCA CTGCTGATGT GATGCCGTCC AAGCAGTAGT AGTGTGGGTT GGTAGCAGTA AAAGGGTTTT GTCAGCTTGG
TTAGGTTTTC CTATCTACAA TATATCTATC TATCTTTTTC ATGTGTTGTC AAAATACAGT GAGATATGCT TACATATTTC
TGCATCTGAG TACTGCTCAG GGGTGATGCA ACGAAGCATC AGGTACATAT CTATATATTT AGAGGGCTCA GGGCTCCATC
GTTTAGCCTT CAGTTTACAG GCATAAGAAA AAATAAATTT TATAGTTAAT TTTTAGGTTT TTTTTATCGT AATTTATTTT
TTCAGTATTT ACTAAGAACA TGTGTATAAA AGTTTTATCT ATATATTATT TTTTAATCAC TAATATACTG TTTCGCTTAT
AACTATATAG TAGTATAAGG TATAGACTTG CATGATGTCT ATCTACATGC ATGCATGGGA TGCATATGTA GGATAGGCTT
GGCTTGAGAG ATGTCTAGCT AGCTATGGGT TTTTCATCAG CTACAGGGCA ATTAATTTAT AGATATGCAT AATATATTGT
GTTCAGAAGT CAAAAGAAGG CCAAGTTGGA ATCATGCATA CCTGCACTGC ACTCATGCCA GTTGCAAGCT TGCAATTGCA
ACTGGGCTTG CTTCTTTTCT TTTCAGCTGG TTTGGCTTGC ATATTTTCCA TGTTATGATC TTCTGATGTA GCCTTTTGAC
TATATATCAA GGATGGACTA AATGTTAGTT TACACAATAA GGAAAAGGAT GGAAATGTTA CACTCATGTC ATCATATACT
ATAACTTAAG GTAAATTAAG ATCAATTTAC ATTAATTTTA TTAAGAAAAA GTTGACTCAA GAAAGCTGCA GTTTATGTTA
TAATTTTAAC TTATTATGTT AGCATATGGG GTTTTCATTT TTAATTCTTC ATAGTACTAC TTCAGTACAT ATCCATATGT
ATACTGTCAT TTTCAGACAC AGGTCCCATC AATTAAATCA CGGAAATGCA TGAGTACATA GTTTTCAAAA CAATAATTAT
CACAATAATG GCATAATTGA TGCTATGATG GACAGGCCAA TGATAAGTTA GTTCCAACAA TTTAAGATCA TACATAGCTA
GTTTCTAAAG CAAAAGAAAA GCATGCAACT GATGGGACAT AACAAACTTG ATAGCTCCAC AAAATGGGCA TAAGAAATTT
TCTGATGAAA GTTAGGTATC ATTGTCTAAC CAAATAGACA TTGGAAAAGG ATCAAGCATA CCAATTGATA TTTTCATTTT
TGCTCTAAAA AATGACTACA TAAGTGGTTT TGAAAGCGAA AGCGAATATT GCCATTGGAG AAAATGTCTA CCAACTAAGA
CAATAATATA TCAGATTTTC CTTAACTATC TTTGTGTATG CTGAATGAGA GCTCACATAC TAGGAGAGAT TACTCACCAC
TCACTGACTG TACTCAGAAC CAGGTAGTGG CCTAATCAGA GTTTGCTGAG AGAAAATATG ATGAAATGGA CAAGAAAACC
CTCACTTAGG TAGTTAGAAG ACTCCTCTCA GGGTCCCTCT CCAACAAACT GTATATATTT GTGTATCAAC CAATCTGACA
TATATGCAGT GGTTTCCAAT TAATGGCAAT ATCCAACCAC CAACTGATGC AGCAACAGAG TGAGTACTTG AAGCATCCTT
ATCTACCAGA AAGCTCTGCA AGCTTAATTA GCAAAGTACA GCAGGTTTTC atgtagaaaa tgatgtgttt agttgggata
tacatgatat atactttttg aaactcctct tagttctcta tcaccataca tacatcagcc attaatatat aatatccata
ctagtacaag aatattaatc TTAATGCCTT AATCAACTCA AAAGCCTAAG CTTAATTATC ACAAGCACAT CATTTTGGAA
ACATATTGAT AGCAACATGC CAGTGAAGTA GTGAACACAA AGAATGGGAT AATAATGATC AAGAATGCAT CAGGTTAAGA
ACAGAATGGC TAGGAAATCT TCACAGTAAC CATTTTGCTA TATGAAAAGT GCAAGACAAG AAGGAAGAAC AACCTCTTTT
TGTCAAATGC AACAGACAGG GGCCCACATG GAAGTACACA CATGTCTGAT GAGAATAAAA TGATCCAGGC CCCTAAAGAG
CATATCTATG CTATCCATAT AAAGCCAAAC AAAAGAAAGG AGGCACACAT GCAAGGAGTC CTCTTTATGG TAAGATAAAA
TGAAATGTCC CAGAGGTTGT GTAGTGGCAG GGGCAGTGAT ACTTGTGATC CACGCACTGA TGGGTCTTTC CATGGAGCAG
TGGAAAAAAG TATGGCCAAT CCTGTCAACA ACACATTTTT GCCCATTGGA AAATTTGTCA CCCCTCGGCT GCATGATGTA
CTGCTGATTC TGTGGCCTAT CCATGCATCA CAAGATTCAC AAGAAACGAA TATATCACGT CTTGTAGATG GTGGTGCACA
AGCACAGAGG CATACACATA TACCCATCAG TGTATCATCT TTTCTAACTC ATCAGGCAGG CATGCCGAGG GAGGGTGGGT
GCAGCTTTTG ATTTGCTGCA GCCATCAATC AGTCAAAGAC CTTGCTCCTC TTTCTCCAGC TTCTTTTTAC TTGTCATGGC
ACATCCAACC TGATTCTGTG ATAACAGCAT TCTTTTGATA AAATCAATTT CAAGTTGATT GTGCTCACTT GCTGATATCC
TCCCTCACTC TGTTGCAGTG CTATTGTGAA TGAGTACATT GAAGCCATGA AGAAGCTCGC ATGTGAGATC CTGGACCTGT
TAGGAGAGGG GCTAGGTCTC AAGGACCCCA GATACTTCAG CAAGCTTACC ACAAACGCTG ACAGTGACTG CCTCCTGAGG
ATCAACCACT ACCCTCCATC ATGCAACATT CACAAACTTG ACCATGATGA CCAATGCAAT ATCAAGAGCC TTGTTAGCAC
CAAGGCTAGC AATGGTGGGA ATCTGATGGC AGGTGGGCGC ATTGGGTTCG GCGAGCACTC TGACCCGCAG ATCCTTAGCT
TGCTCCGAGC AAACGATGTG GAAGGGCTAC AGGTGTTTGT GCCGGACCAC GAGGGCAAGG AGATGTGGGT TCAGGTGCCA
TCGGACCCAT CGGCCATTTT CGTCAATGTT GGTGATGTCC TCCAGGTAGT CACAGTAAAT GACTAGAGCA AAAAAAAACA
GCATTACATA TATCAGAATA AGGTTTACTA TTATCAAAAG AAATTATTTC ATAGATTATA AAAGGACCGC AAAGAAATTA
TTTCATAGAT TATAAAAGGA CCGCATTGAC TATCATATGA TTTACAAATT ATGTGGCTTT CTTCCAGTTA TTCATAAAAA
ATGTTTCTTT GCTCACTGCA AAACACACAG GAAAGTAATA TATATTTAAT CATTTGATTC ATAAGGCTGC AGCACTGCTG
AACAATGTTT CTTTTGTCAA AAAAAATGCA ACACTGATAT GTTTGTTATT TTCAGACTCA AATTCATTGT ATTGCTGCAA
TTCTTACCAG CTGACAAAAA AATCTCTTTC TATCCTGCAA CTACCGCTGT TTTACTCAAC TTAAAAAAAC AAATCACTAA
AACATGATGC TGTAAGCCTG GACATAGTTT TGCATTCCTG ACATTCTTCG GCTTATCCTT TCTTTGGCCT TTATTTCTTC
AGGCTCTGAC AAATGGGAGG CTGATAAGTA TCCGGCACAG GGTAATTGCA ACCGCCTGCA GGCCAAGGCT GTCCACAATA
TACTTCGCAT CACCACCCCT GCATGCACGA ATCTCGGCAC TCCCAGAGAC AATCACAGCC AGCAGCCCAC GCCGATACCG
ATCATTCACC TGGGCTGAGT ACAAGACGAC AATGTACTCA CTCCGCCTGA GCCACAGCCG CCTAGAACTC TTCAAAATTG
ACGATGATGA CAGCGACAAT GCCAGTGAGG GAAAAGCATA GGAATTGCTG GTTAAATTGC AGACGATGCC TATGGACCAG
TGGGGATTAG GAAGCTGAAA CTGTCCCCAA AATTTTGGCT CTCTGGCAGT CTGGCTACTA TCGTCAGATA TCTCACTATT
ATGATGGTGT AGTGCCTAAG TTGACGGGTG TGTAATATCG TTAGCAGTCT ACAGAAGCTA TGGTTGTACG GAAGTAATGT
ACTGTCGCCT TTTCAGCTAA CTATCCATGT TCTCTCTTAT ATGTAATGAG TTAGTTGACG GATGTGTAAT ATTGCTAGCA
TTGTATATAA GCTATGGTTG TATGGAAGTA TGTAATATAG CCTTTTCAGC TAACTATCCG TGTTCCCTTT GTCCCTCTAA
AGCACAAAAG TAAGACCTAA CTACAGAGCA CAATAGATAG TTTTTGAGAA CTATGATCTA TTAAGAAATC TTAAGAGAAA
TCAGAATACT TTTG

Locus: Os05g0158600

Loading...

Locus: Os05g0158600

Loading...