Os05t0158600-02

Locus

Os05g0158600

Description

GA 2-oxidase1, GA metabolism

RAP-DB Gene Symbol Synonym(s)

GA2OX1, OsGA2ox1, ga2ox-1, OsGA2ox-1, ga2ox, ga2ox 1, GA2ox1

RAP-DB Gene Name Synonym(s)

GIBBERELLIN 2-OXIDASE 1, Oryza sativa GA 2-oxidase 1, rice GA 2-oxidase1, GA 2-oxidase 1, Gibberellin 2-oxidase 1

CGSNL Gene Symbol

GA2OX1

CGSNL Gene Name

GIBBERELLIN 2-OXIDASE 1

Oryzabase Gene Symbol Synonym(s)

OsGA2ox1, ga2ox-1, OsGA2ox-1, ga2ox, ga2ox 1, GA2ox1

Oryzabase Gene Name Synonym(s)

rice GA 2-oxidase1, GA 2-oxidase 1, Gibberellin 2-oxidase 1

Transcript Evidence

AB059416 (Genbank)

Protein Evidence

Q9AVA5 (UniProt)

Literature

PMID: 11244129

PMID: 15075394

Note

Manual Curation

May 19, 2009

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors (GO:0016706)

Functional domain (InterPro)

Oxoglutarate/iron-dependent oxygenase (IPR005123)

Others

Oryzabase (5114)

Transcript

1526 bp

>Os05t0158600-02 GA 2-oxidase1, GA metabolism
CCATTCCGGCCGCGCATTCTCCCGCTCTCGATCGATCGATCGATCATGGTGGTGCCTTCC
GCGACGACGCCAGCGAGGCAGGAGACGGTGGTGGCGGCGGCGCCGCCAGCTGCGGCGGCG
TCCGGTGTCGTCGGCGGCGGCGGCGGCGTGACGATAGCGACGGTGGACATGTCGGCGGAG
CGCGGCGCGGTGGCGAGGCAGGTGGCGACGGCGTGCGCGGCGCACGGGTTCTTCCGGTGC
GTCGGGCACGGCGTGCCGGCGGCGGCGCCCGTCGCGGCGAGGCTGGACGCCGCGACGGCG
GCGTTCTTCGCGATGGCGCCGGCGGAGAAGCAGCGCGCCGGGCCGGCGAGCCCGCTCGGG
TACGGCTGCCGGAGCATCGGGTTCAACGGCGACGTCGGCGAGCTGGAGTACCTGCTCCTC
CACGCCAACCCCGCCGCCGTCGCGCACCGGGCCAGGACCATCGACGCCATGGACCCCTCT
CGCTTCAGTGCTATTGTGAATGAGTACATTGAAGCCATGAAGAAGCTCGCATGTGAGATC
CTGGACCTGTTAGGAGAGGGGCTAGGTCTCAAGGACCCCAGATACTTCAGCAAGCTTACC
ACAAACGCTGACAGTGACTGCCTCCTGAGGATCAACCACTACCCTCCATCATGCAACATT
CACAAACTTGACCATGATGACCAATGCAATATCAAGAGCCTTGTTAGCACCAAGGCTAGC
AATGGTGGGAATCTGATGGCAGGTGGGCGCATTGGGTTCGGCGAGCACTCTGACCCGCAG
ATCCTTAGCTTGCTCCGAGCAAACGATGTGGAAGGGCTACAGGTGTTTGTGCCGGACCAC
GAGGGCAAGGAGATGTGGGTTCAGGTGCCATCGGACCCATCGGCCATTTTCGTCAATGTT
GGTGATGTCCTCCAGGCTCTGACAAATGGGAGGCTGATAAGTATCCGGCACAGGGTAATT
GCAACCGCCTGCAGGCCAAGGCTGTCCACAATATACTTCGCATCACCACCCCTGCATGCA
CGAATCTCGGCACTCCCAGAGACAATCACAGCCAGCAGCCCACGCCGATACCGATCATTC
ACCTGGGCTGAGTACAAGACGACAATGTACTCACTCCGCCTGAGCCACAGCCGCCTAGAA
CTCTTCAAAATTGACGATGATGACAGCGACAATGCCAGTGAGGGAAAAGCATAGGAATTG
CTGGTTAAATTGCAGACGATGCCTATGGACCAGTGGGGATTAGGAAGCTGAAACTGTCCC
CAAAATTTTGGCTCTCTGGCAGTCTGGCTACTATCGTCAGATATCTCACTATTATGATGG
TGTAGTGCCTAAGTTGACGGGTGTGTAATATCGTTAGCAGTCTACAGAAGCTATGGTTGT
ACGGAAGTAATGTACTGTCGCCTTTTCAGCTAACTATCCATGTTCTCTCTTATATGTAAT
GAGTTAGTTGACGGATGTGTAATATTGCTAGCATTGTATATAAGCTATGGTTGTATGGAA
GTATGTAATATAGCCTTTTCAGCTAA

CDS

1149 bp

>Os05t0158600-02 GA 2-oxidase1, GA metabolism
ATGGTGGTGCCTTCCGCGACGACGCCAGCGAGGCAGGAGACGGTGGTGGCGGCGGCGCCG
CCAGCTGCGGCGGCGTCCGGTGTCGTCGGCGGCGGCGGCGGCGTGACGATAGCGACGGTG
GACATGTCGGCGGAGCGCGGCGCGGTGGCGAGGCAGGTGGCGACGGCGTGCGCGGCGCAC
GGGTTCTTCCGGTGCGTCGGGCACGGCGTGCCGGCGGCGGCGCCCGTCGCGGCGAGGCTG
GACGCCGCGACGGCGGCGTTCTTCGCGATGGCGCCGGCGGAGAAGCAGCGCGCCGGGCCG
GCGAGCCCGCTCGGGTACGGCTGCCGGAGCATCGGGTTCAACGGCGACGTCGGCGAGCTG
GAGTACCTGCTCCTCCACGCCAACCCCGCCGCCGTCGCGCACCGGGCCAGGACCATCGAC
GCCATGGACCCCTCTCGCTTCAGTGCTATTGTGAATGAGTACATTGAAGCCATGAAGAAG
CTCGCATGTGAGATCCTGGACCTGTTAGGAGAGGGGCTAGGTCTCAAGGACCCCAGATAC
TTCAGCAAGCTTACCACAAACGCTGACAGTGACTGCCTCCTGAGGATCAACCACTACCCT
CCATCATGCAACATTCACAAACTTGACCATGATGACCAATGCAATATCAAGAGCCTTGTT
AGCACCAAGGCTAGCAATGGTGGGAATCTGATGGCAGGTGGGCGCATTGGGTTCGGCGAG
CACTCTGACCCGCAGATCCTTAGCTTGCTCCGAGCAAACGATGTGGAAGGGCTACAGGTG
TTTGTGCCGGACCACGAGGGCAAGGAGATGTGGGTTCAGGTGCCATCGGACCCATCGGCC
ATTTTCGTCAATGTTGGTGATGTCCTCCAGGCTCTGACAAATGGGAGGCTGATAAGTATC
CGGCACAGGGTAATTGCAACCGCCTGCAGGCCAAGGCTGTCCACAATATACTTCGCATCA
CCACCCCTGCATGCACGAATCTCGGCACTCCCAGAGACAATCACAGCCAGCAGCCCACGC
CGATACCGATCATTCACCTGGGCTGAGTACAAGACGACAATGTACTCACTCCGCCTGAGC
CACAGCCGCCTAGAACTCTTCAAAATTGACGATGATGACAGCGACAATGCCAGTGAGGGA
AAAGCATAG

Protein

382 aa

>Os05t0158600-02 GA 2-oxidase1, GA metabolism
MVVPSATTPARQETVVAAAPPAAAASGVVGGGGGVTIATVDMSAERGAVARQVATACAAH
GFFRCVGHGVPAAAPVAARLDAATAAFFAMAPAEKQRAGPASPLGYGCRSIGFNGDVGEL
EYLLLHANPAAVAHRARTIDAMDPSRFSAIVNEYIEAMKKLACEILDLLGEGLGLKDPRY
FSKLTTNADSDCLLRINHYPPSCNIHKLDHDDQCNIKSLVSTKASNGGNLMAGGRIGFGE
HSDPQILSLLRANDVEGLQVFVPDHEGKEMWVQVPSDPSAIFVNVGDVLQALTNGRLISI
RHRVIATACRPRLSTIYFASPPLHARISALPETITASSPRRYRSFTWAEYKTTMYSLRLS
HSRLELFKIDDDDSDNASEGKA*

5'UTR

chr05:3459616..3459660 (+ strand) : 45 bp

CDS

chr05:3459661..3460103 (+ strand) : 443 bp

chr05:3464314..3464740 (+ strand) : 427 bp

chr05:3465258..3465536 (+ strand) : 279 bp

3'UTR

chr05:3465537..3465868 (+ strand) : 332 bp

FASTA

>Os05t0158600-02 class=Sequence position=chr05:3459616..3465868 (+ strand)
CCATTCCGGC CGCGCATTCT CCCGCTCTCG ATCGATCGAT CGATCATGGT GGTGCCTTCC GCGACGACGC CAGCGAGGCA
GGAGACGGTG GTGGCGGCGG CGCCGCCAGC TGCGGCGGCG TCCGGTGTCG TCGGCGGCGG CGGCGGCGTG ACGATAGCGA
CGGTGGACAT GTCGGCGGAG CGCGGCGCGG TGGCGAGGCA GGTGGCGACG GCGTGCGCGG CGCACGGGTT CTTCCGGTGC
GTCGGGCACG GCGTGCCGGC GGCGGCGCCC GTCGCGGCGA GGCTGGACGC CGCGACGGCG GCGTTCTTCG CGATGGCGCC
GGCGGAGAAG CAGCGCGCCG GGCCGGCGAG CCCGCTCGGG TACGGCTGCC GGAGCATCGG GTTCAACGGC GACGTCGGCG
AGCTGGAGTA CCTGCTCCTC CACGCCAACC CCGCCGCCGT CGCGCACCGG GCCAGGACCA TCGACGCCAT GGACCCCTCT
CGCTTCAGGT ACGTACAATA CCACCACTCA CTCTTAGCCT AGCTTAATCG ATTAGTTTTT TACTCCCTCC ATTTCTCCGT
TTCCCCGTTT CATGTTATAA GATGTTATGG GTTTTTGAAT ATATAGATTC ACGTTTCACG CTATAAAATG TTCTGGGTTT
TGAATAAATT CATGCATGAT CTATTGATGA ACTTTTAAGA GTCCAAAACA TTTTGTAACA TGGAACGGAT GGAGTGGCGT
ATTGTGTTGC GCCTACGTGT CAAAGTATGC ATGCTTACAT GGCACACGTA TTTAAAACAT TGTTATGCAT GTATATAACT
AATGTTCTCT ATGGTTTAAT TTTTTCTTAA TGCTACCCAT GCATATTCTA TAATAAATAA AGTGTGCCGG ACTCCGGTCA
CAGAAGAATA TATTTGTTTT AATGTATCAG TTTAACTTCG ACGATAATTA TTATTGTTCG AAGTACAAAT TTTCGGCATA
TTTAATAGTG TGGCCTTGTT CTATCAAAAC ATAATTTTTC GTAAGAGATT ATATACTTGT ATAACTTATT TTTGGATTGT
AGGGATCCTT TCCCTATGGT TTTACTTCAA AAGATGACTT ACATTTGGAT TGGTGATAAA GAATATACAA CTAAGTAGAC
AAAGTTATAT CTAGTTCATT TTGAAAAGTT CAAGGCTCTT TTTTCAACGG GAAAGGAGTA TCCTATATAA GATATATTAT
ACAGTTAACT CTGTGCCTTT TAAAAGCTCT GTTGACAGTA AAATCTCATG TAGCTGGTTC ATCCAAAAAA AAAATTCTCA
TGTAGCTGGG CATACACGAG CTTTTTTTTT TTTTAAGAAC TTACATACAC GAGCTTAATT ACTTCTCTCG ATCCTTTTGC
GGATGCGCTT GGTTGCTCGT AATAAATTTT GTCACAAATC TTTGATAACC CCACCATTTC CCAAATTTAA GCATACATGG
TGGTAGAACT ATATTCACTA AGTTTTACAG TGTCGTTGTT ACAACAATAA ACTAATATTG CAAATATTGC AATAGTTACA
ATATAATTAA TTTCTTCTAT GTATTATGTA CTGAAACGCA TATCAATCAC ATGCATGGCA CTGCATATAT GGTCTTAAAC
TATATATGAG GCAACGTGAA TAATATATAT TATTAATTAA GTATTACCCG TATACACACA CATACACATA TAATTAAAGA
TTGTCATTTT TATTATTTTT GCTAGACCCC TCGTCCCTGT GCATCACTAA AGTATTTTTA TTGAACTAGC TGACCTCTAC
AGGGGTTTAA AGCTTGATTA CTTAATTAAA CTGTTAATGA AAGACGACTA TATATGATCC AATAATATGT TAATTAAGAC
GGTGCATGGG TGTCCGGTGT CCCTGCAGTG TGAGATGAAC ATGCAAAAAA AATTAAATAT ATATCATGCT GTGTTCCTTA
ACTAACCGGC CACATCTACA TATTCATGTC ATAATCCTGC ATCTGTCTCA CTGCTGATGT GATGCCGTCC AAGCAGTAGT
AGTGTGGGTT GGTAGCAGTA AAAGGGTTTT GTCAGCTTGG TTAGGTTTTC CTATCTACAA TATATCTATC TATCTTTTTC
ATGTGTTGTC AAAATACAGT GAGATATGCT TACATATTTC TGCATCTGAG TACTGCTCAG GGGTGATGCA ACGAAGCATC
AGGTACATAT CTATATATTT AGAGGGCTCA GGGCTCCATC GTTTAGCCTT CAGTTTACAG GCATAAGAAA AAATAAATTT
TATAGTTAAT TTTTAGGTTT TTTTTATCGT AATTTATTTT TTCAGTATTT ACTAAGAACA TGTGTATAAA AGTTTTATCT
ATATATTATT TTTTAATCAC TAATATACTG TTTCGCTTAT AACTATATAG TAGTATAAGG TATAGACTTG CATGATGTCT
ATCTACATGC ATGCATGGGA TGCATATGTA GGATAGGCTT GGCTTGAGAG ATGTCTAGCT AGCTATGGGT TTTTCATCAG
CTACAGGGCA ATTAATTTAT AGATATGCAT AATATATTGT GTTCAGAAGT CAAAAGAAGG CCAAGTTGGA ATCATGCATA
CCTGCACTGC ACTCATGCCA GTTGCAAGCT TGCAATTGCA ACTGGGCTTG CTTCTTTTCT TTTCAGCTGG TTTGGCTTGC
ATATTTTCCA TGTTATGATC TTCTGATGTA GCCTTTTGAC TATATATCAA GGATGGACTA AATGTTAGTT TACACAATAA
GGAAAAGGAT GGAAATGTTA CACTCATGTC ATCATATACT ATAACTTAAG GTAAATTAAG ATCAATTTAC ATTAATTTTA
TTAAGAAAAA GTTGACTCAA GAAAGCTGCA GTTTATGTTA TAATTTTAAC TTATTATGTT AGCATATGGG GTTTTCATTT
TTAATTCTTC ATAGTACTAC TTCAGTACAT ATCCATATGT ATACTGTCAT TTTCAGACAC AGGTCCCATC AATTAAATCA
CGGAAATGCA TGAGTACATA GTTTTCAAAA CAATAATTAT CACAATAATG GCATAATTGA TGCTATGATG GACAGGCCAA
TGATAAGTTA GTTCCAACAA TTTAAGATCA TACATAGCTA GTTTCTAAAG CAAAAGAAAA GCATGCAACT GATGGGACAT
AACAAACTTG ATAGCTCCAC AAAATGGGCA TAAGAAATTT TCTGATGAAA GTTAGGTATC ATTGTCTAAC CAAATAGACA
TTGGAAAAGG ATCAAGCATA CCAATTGATA TTTTCATTTT TGCTCTAAAA AATGACTACA TAAGTGGTTT TGAAAGCGAA
AGCGAATATT GCCATTGGAG AAAATGTCTA CCAACTAAGA CAATAATATA TCAGATTTTC CTTAACTATC TTTGTGTATG
CTGAATGAGA GCTCACATAC TAGGAGAGAT TACTCACCAC TCACTGACTG TACTCAGAAC CAGGTAGTGG CCTAATCAGA
GTTTGCTGAG AGAAAATATG ATGAAATGGA CAAGAAAACC CTCACTTAGG TAGTTAGAAG ACTCCTCTCA GGGTCCCTCT
CCAACAAACT GTATATATTT GTGTATCAAC CAATCTGACA TATATGCAGT GGTTTCCAAT TAATGGCAAT ATCCAACCAC
CAACTGATGC AGCAACAGAG TGAGTACTTG AAGCATCCTT ATCTACCAGA AAGCTCTGCA AGCTTAATTA GCAAAGTACA
GCAGGTTTTC atgtagaaaa tgatgtgttt agttgggata tacatgatat atactttttg aaactcctct tagttctcta
tcaccataca tacatcagcc attaatatat aatatccata ctagtacaag aatattaatc TTAATGCCTT AATCAACTCA
AAAGCCTAAG CTTAATTATC ACAAGCACAT CATTTTGGAA ACATATTGAT AGCAACATGC CAGTGAAGTA GTGAACACAA
AGAATGGGAT AATAATGATC AAGAATGCAT CAGGTTAAGA ACAGAATGGC TAGGAAATCT TCACAGTAAC CATTTTGCTA
TATGAAAAGT GCAAGACAAG AAGGAAGAAC AACCTCTTTT TGTCAAATGC AACAGACAGG GGCCCACATG GAAGTACACA
CATGTCTGAT GAGAATAAAA TGATCCAGGC CCCTAAAGAG CATATCTATG CTATCCATAT AAAGCCAAAC AAAAGAAAGG
AGGCACACAT GCAAGGAGTC CTCTTTATGG TAAGATAAAA TGAAATGTCC CAGAGGTTGT GTAGTGGCAG GGGCAGTGAT
ACTTGTGATC CACGCACTGA TGGGTCTTTC CATGGAGCAG TGGAAAAAAG TATGGCCAAT CCTGTCAACA ACACATTTTT
GCCCATTGGA AAATTTGTCA CCCCTCGGCT GCATGATGTA CTGCTGATTC TGTGGCCTAT CCATGCATCA CAAGATTCAC
AAGAAACGAA TATATCACGT CTTGTAGATG GTGGTGCACA AGCACAGAGG CATACACATA TACCCATCAG TGTATCATCT
TTTCTAACTC ATCAGGCAGG CATGCCGAGG GAGGGTGGGT GCAGCTTTTG ATTTGCTGCA GCCATCAATC AGTCAAAGAC
CTTGCTCCTC TTTCTCCAGC TTCTTTTTAC TTGTCATGGC ACATCCAACC TGATTCTGTG ATAACAGCAT TCTTTTGATA
AAATCAATTT CAAGTTGATT GTGCTCACTT GCTGATATCC TCCCTCACTC TGTTGCAGTG CTATTGTGAA TGAGTACATT
GAAGCCATGA AGAAGCTCGC ATGTGAGATC CTGGACCTGT TAGGAGAGGG GCTAGGTCTC AAGGACCCCA GATACTTCAG
CAAGCTTACC ACAAACGCTG ACAGTGACTG CCTCCTGAGG ATCAACCACT ACCCTCCATC ATGCAACATT CACAAACTTG
ACCATGATGA CCAATGCAAT ATCAAGAGCC TTGTTAGCAC CAAGGCTAGC AATGGTGGGA ATCTGATGGC AGGTGGGCGC
ATTGGGTTCG GCGAGCACTC TGACCCGCAG ATCCTTAGCT TGCTCCGAGC AAACGATGTG GAAGGGCTAC AGGTGTTTGT
GCCGGACCAC GAGGGCAAGG AGATGTGGGT TCAGGTGCCA TCGGACCCAT CGGCCATTTT CGTCAATGTT GGTGATGTCC
TCCAGGTAGT CACAGTAAAT GACTAGAGCA AAAAAAAACA GCATTACATA TATCAGAATA AGGTTTACTA TTATCAAAAG
AAATTATTTC ATAGATTATA AAAGGACCGC AAAGAAATTA TTTCATAGAT TATAAAAGGA CCGCATTGAC TATCATATGA
TTTACAAATT ATGTGGCTTT CTTCCAGTTA TTCATAAAAA ATGTTTCTTT GCTCACTGCA AAACACACAG GAAAGTAATA
TATATTTAAT CATTTGATTC ATAAGGCTGC AGCACTGCTG AACAATGTTT CTTTTGTCAA AAAAAATGCA ACACTGATAT
GTTTGTTATT TTCAGACTCA AATTCATTGT ATTGCTGCAA TTCTTACCAG CTGACAAAAA AATCTCTTTC TATCCTGCAA
CTACCGCTGT TTTACTCAAC TTAAAAAAAC AAATCACTAA AACATGATGC TGTAAGCCTG GACATAGTTT TGCATTCCTG
ACATTCTTCG GCTTATCCTT TCTTTGGCCT TTATTTCTTC AGGCTCTGAC AAATGGGAGG CTGATAAGTA TCCGGCACAG
GGTAATTGCA ACCGCCTGCA GGCCAAGGCT GTCCACAATA TACTTCGCAT CACCACCCCT GCATGCACGA ATCTCGGCAC
TCCCAGAGAC AATCACAGCC AGCAGCCCAC GCCGATACCG ATCATTCACC TGGGCTGAGT ACAAGACGAC AATGTACTCA
CTCCGCCTGA GCCACAGCCG CCTAGAACTC TTCAAAATTG ACGATGATGA CAGCGACAAT GCCAGTGAGG GAAAAGCATA
GGAATTGCTG GTTAAATTGC AGACGATGCC TATGGACCAG TGGGGATTAG GAAGCTGAAA CTGTCCCCAA AATTTTGGCT
CTCTGGCAGT CTGGCTACTA TCGTCAGATA TCTCACTATT ATGATGGTGT AGTGCCTAAG TTGACGGGTG TGTAATATCG
TTAGCAGTCT ACAGAAGCTA TGGTTGTACG GAAGTAATGT ACTGTCGCCT TTTCAGCTAA CTATCCATGT TCTCTCTTAT
ATGTAATGAG TTAGTTGACG GATGTGTAAT ATTGCTAGCA TTGTATATAA GCTATGGTTG TATGGAAGTA TGTAATATAG
CCTTTTCAGC TAA

Locus: Os05g0158600

Loading...

Locus: Os05g0158600

Loading...