Os05t0164800-01

Locus

Os05g0164800

Description

Transition metal ion transporter, Ion transport

RAP-DB Gene Symbol Synonym(s)

ZIP6, OsZIP6

RAP-DB Gene Name Synonym(s)

ZINC TRANSPORTER 6, zinc transporter 6, Zrt-Irt-like protein 6, Zinc-regulated transporter 6

CGSNL Gene Symbol

ZIP6

CGSNL Gene Name

ZINC TRANSPORTER 6

Oryzabase Gene Symbol Synonym(s)

OsZIP6

Oryzabase Gene Name Synonym(s)

zinc transporter 6, Zrt-Irt-like protein 6, Zinc-regulated transporter 6

Transcript Evidence

AK120502

AB126088

Protein Evidence

Q6L8F9

Literature

PMID: 26476396

PMID: 16263903

Note

Manual Curation

November 5, 2015

Gene Ontology (GO)

Biological Process: metal ion transport (GO:0030001)

Biological Process: transmembrane transport (GO:0055085)

Biological Process: zinc II ion transmembrane transport (GO:0071577)

Molecular Function: zinc ion transmembrane transporter activity (GO:0005385)

Molecular Function: metal ion transmembrane transporter activity (GO:0046873)

Cellular Component: membrane (GO:0016020)

Cellular Component: integral component of membrane (GO:0016021)

Functional domain (InterPro)

Zinc/iron permease (IPR003689)

Zinc/iron permease, fungal/plant (IPR004698)

Full-length cDNA

J013122I02 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0164800-01)

RiceXPro (AK120502)

Others

Oryzabase (8377)

KEGG (Os05t0164800-01)

Transcript

1402 bp

>Os05t0164800-01 Transition metal ion transporter, Ion transport
CCGTCCACTCGCCGACTCGCCTCTCCTCCTCGCTCGCCGTCGCCGTCGCGGGAGACTCCG
GCGAGCGCGTTGACGTGGCCATGTCGGGGACGGGGTGCTTCCCGGCGGGGGAGATGGCGG
CGGTGGCGAGGGTGTGCCGGGACGGGGCGGCGGCGGCGAGGCTCAAGACGGGCTCCCTGC
TCGCCATCCTCGTGGCGAGCGCCGTCGGCATCTGCCTCCCCGTGGCGCTCACGGGGGCGT
TCCGCGGGAAGGCCGGGTACGCGCGCGGCCTCCTCCTCGTCAAGTGCTACGCCGCCGGGG
TCATCCTCTCCACCTCGCTCGTCCACGTCCTCCCCGACGCGCACGCCGCGCTCGCCGACT
GCGCCGTCGCCACGCGCCGCCCGTGGCGGGACTTCCCCTTCGCGGGCCTCTTCTCCCTCG
TCGGCGCGCTCCTCGCCCTCCTCGTCGACCTCTCCGCCTCCTCCCACCTCGAAGCCCACG
GCCACCACCAGCACGCGGAGGAGGGGGAGTCGCCGCCGCCGCCGCCGCCGACCCACCAAC
CCTACGCCCCAATCCCCACCACCAAGAAGTCCCCCGTCTTCGAGCTCTCCGGCGAGATGA
GCCCCAAGAAGCGCGCGCACTCAGACGACACGGACCGGGACGACGTGGCGCTCTTCGGGG
CCAAGAGCGCGGTCCGGAGCGACGAGGTCGTCGTCGCCCCCCGTGTCGGCTGCCATGGGC
ACCACGACGTGGTGGAGGTTGGGGAGGAAGGAGGAGGAGGGGAGGAGGAGGAGGCGAGGA
GGAAGCAGAAGATGGTGTCCAAGGTGCTCGAGATTGGGATCGTGTTCCACTCGGTCATCA
TCGGGGTCACCATGGGGATGTCTCAGGATGTCTGCGCCATCCGGCCGCTCGTCGTCGCGC
TCTCCTTCCACCAGGTGTTCGAAGGAATGGGCCTCGGCGGCTGCATTGCGCAGGCAGGTT
TTGGGATTGCAACGGTGGGTTACATGTGCGTAATGTTCTCGGTGACAACACCATTGGGAA
TACTTCTTGGAATGGCAATATTCCATATGACTGGCTATGATGATAGCAGTCCAAATGCCC
TAATAATAGAAGGGCTCCTTGGCTCACTTTCTTCTGGAATCCTTGTCTACATGGCACTTG
TCGATCTCATTTCTCTTGATTTCTTCCACAATAAAATGATGTCATCATCTAATAAATTGA
AAAAGGTCTCTTATGTCGCATTAGTGCTTGGATCTGCATCCATGTCTATATTAGCTCTCT
GGGCATAGGTCATAGGTGCAACCAGAGTGAAATACGGTGTATTGATCCTTTGTAGGAAGA
AATGGATGTTTTGGGAGTCAGGACTTCCCTCATGTAAATTAAACTTCCACATAATGGGAA
ACTTAAAAATTCTTGAATGCCT

CDS

1188 bp

>Os05t0164800-01 Transition metal ion transporter, Ion transport
ATGTCGGGGACGGGGTGCTTCCCGGCGGGGGAGATGGCGGCGGTGGCGAGGGTGTGCCGG
GACGGGGCGGCGGCGGCGAGGCTCAAGACGGGCTCCCTGCTCGCCATCCTCGTGGCGAGC
GCCGTCGGCATCTGCCTCCCCGTGGCGCTCACGGGGGCGTTCCGCGGGAAGGCCGGGTAC
GCGCGCGGCCTCCTCCTCGTCAAGTGCTACGCCGCCGGGGTCATCCTCTCCACCTCGCTC
GTCCACGTCCTCCCCGACGCGCACGCCGCGCTCGCCGACTGCGCCGTCGCCACGCGCCGC
CCGTGGCGGGACTTCCCCTTCGCGGGCCTCTTCTCCCTCGTCGGCGCGCTCCTCGCCCTC
CTCGTCGACCTCTCCGCCTCCTCCCACCTCGAAGCCCACGGCCACCACCAGCACGCGGAG
GAGGGGGAGTCGCCGCCGCCGCCGCCGCCGACCCACCAACCCTACGCCCCAATCCCCACC
ACCAAGAAGTCCCCCGTCTTCGAGCTCTCCGGCGAGATGAGCCCCAAGAAGCGCGCGCAC
TCAGACGACACGGACCGGGACGACGTGGCGCTCTTCGGGGCCAAGAGCGCGGTCCGGAGC
GACGAGGTCGTCGTCGCCCCCCGTGTCGGCTGCCATGGGCACCACGACGTGGTGGAGGTT
GGGGAGGAAGGAGGAGGAGGGGAGGAGGAGGAGGCGAGGAGGAAGCAGAAGATGGTGTCC
AAGGTGCTCGAGATTGGGATCGTGTTCCACTCGGTCATCATCGGGGTCACCATGGGGATG
TCTCAGGATGTCTGCGCCATCCGGCCGCTCGTCGTCGCGCTCTCCTTCCACCAGGTGTTC
GAAGGAATGGGCCTCGGCGGCTGCATTGCGCAGGCAGGTTTTGGGATTGCAACGGTGGGT
TACATGTGCGTAATGTTCTCGGTGACAACACCATTGGGAATACTTCTTGGAATGGCAATA
TTCCATATGACTGGCTATGATGATAGCAGTCCAAATGCCCTAATAATAGAAGGGCTCCTT
GGCTCACTTTCTTCTGGAATCCTTGTCTACATGGCACTTGTCGATCTCATTTCTCTTGAT
TTCTTCCACAATAAAATGATGTCATCATCTAATAAATTGAAAAAGGTCTCTTATGTCGCA
TTAGTGCTTGGATCTGCATCCATGTCTATATTAGCTCTCTGGGCATAG

Protein

396 aa

>Os05t0164800-01 Transition metal ion transporter, Ion transport
MSGTGCFPAGEMAAVARVCRDGAAAARLKTGSLLAILVASAVGICLPVALTGAFRGKAGY
ARGLLLVKCYAAGVILSTSLVHVLPDAHAALADCAVATRRPWRDFPFAGLFSLVGALLAL
LVDLSASSHLEAHGHHQHAEEGESPPPPPPTHQPYAPIPTTKKSPVFELSGEMSPKKRAH
SDDTDRDDVALFGAKSAVRSDEVVVAPRVGCHGHHDVVEVGEEGGGGEEEEARRKQKMVS
KVLEIGIVFHSVIIGVTMGMSQDVCAIRPLVVALSFHQVFEGMGLGGCIAQAGFGIATVG
YMCVMFSVTTPLGILLGMAIFHMTGYDDSSPNALIIEGLLGSLSSGILVYMALVDLISLD
FFHNKMMSSSNKLKKVSYVALVLGSASMSILALWA*

5'UTR

chr05:3810701..3810780 (- strand) : 80 bp

CDS

chr05:3809828..3810700 (- strand) : 873 bp

chr05:3808178..3808492 (- strand) : 315 bp

3'UTR

chr05:3808044..3808177 (- strand) : 134 bp

FASTA

>Os05t0164800-01 class=Sequence position=chr05:3808044..3810780 (- strand)
CCGTCCACTC GCCGACTCGC CTCTCCTCCT CGCTCGCCGT CGCCGTCGCG GGAGACTCCG GCGAGCGCGT TGACGTGGCC
ATGTCGGGGA CGGGGTGCTT CCCGGCGGGG GAGATGGCGG CGGTGGCGAG GGTGTGCCGG GACGGGGCGG CGGCGGCGAG
GCTCAAGACG GGCTCCCTGC TCGCCATCCT CGTGGCGAGC GCCGTCGGCA TCTGCCTCCC CGTGGCGCTC ACGGGGGCGT
TCCGCGGGAA GGCCGGGTAC GCGCGCGGCC TCCTCCTCGT CAAGTGCTAC GCCGCCGGGG TCATCCTCTC CACCTCGCTC
GTCCACGTCC TCCCCGACGC GCACGCCGCG CTCGCCGACT GCGCCGTCGC CACGCGCCGC CCGTGGCGGG ACTTCCCCTT
CGCGGGCCTC TTCTCCCTCG TCGGCGCGCT CCTCGCCCTC CTCGTCGACC TCTCCGCCTC CTCCCACCTC GAAGCCCACG
GCCACCACCA GCACGCGGAG GAGGGGGAGT CGCCGCCGCC GCCGCCGCCG ACCCACCAAC CCTACGCCCC AATCCCCACC
ACCAAGAAGT CCCCCGTCTT CGAGCTCTCC GGCGAGATGA GCCCCAAGAA GCGCGCGCAC TCAGACGACA CGGACCGGGA
CGACGTGGCG CTCTTCGGGG CCAAGAGCGC GGTCCGGAGC GACGAGGTCG TCGTCGCCCC CCGTGTCGGC TGCCATGGGC
ACCACGACGT GGTGGAGGTT GGGGAGGAAG GAGGAGGAGG GGAGGAGGAG GAGGCGAGGA GGAAGCAGAA GATGGTGTCC
AAGGTGCTCG AGATTGGGAT CGTGTTCCAC TCGGTCATCA TCGGGGTCAC CATGGGGATG TCTCAGGATG TCTGCGCCAT
CCGGCCGCTC GTCGTCGCGC TCTCCTTCCA CCAGGTGTTC GAAGGAATGG GCCTCGGCGG CTGCATTGCG CAGGTAAGCG
AAATCCATCT ACCTGACTGC CTTCAATTAC ACCGTTCATG ATCGAATTCC ATGGATCAAT TGTTATGACC ATAGTGGTTT
TGGCTTGAAT CATGATCGAA TTCCGTGAAT CGATAGCTGT TACCGGAGTG GTTTTCGCTT GAATCATGAT CGAATTCCGT
GAATCGATAG CTGTTACCGG AGTGGTTCTT TGCTTGAATT GCTTCTTAGA ATTAATAATT AAAGAGTGCA GCAAAGCAAA
CTAGCTAGGA CTTGTCAAAG CAGTTTTGTG GCTTTCAGTG TGCGTTTCAG TGTTTTAGTA GTATGAATCG CTCATGCCAC
TGTCGCCTGT CATATTGACT TGTTTAGTTT AAAATAAACA TAGGTGTTAT AATATGTGAT TAGCTACCAA TGCTTGCACA
TAAGCAGTAC ACGTGATTGT TACTGTATAA TCTGTTTGTC CCAGATTAGG CCTTACTGCT GTTATTATCG TTTAAAATTC
AGAGATGAAA GGCGCTATAT ACCAATATCA CCATGCCAGG TGCTGAATGA TAGAAAGTGA TTTATTAACC CCCCTTTGCA
CCCCCTGAAG TATTTCTGTA ACTTTGGAAT GGTTCTTGGT GGAAACCTGC AAGGATCCCT GTTGTACACC ACTAGCAACT
GGAACCTAGT CACCATATGA CTATAACATA TACTTTAGCA GTGAAAGTAT CCATGTCAGA ATCTTTTACA CATCTAAATC
CATGATCTGT CCAATTTTGT TCATCCACGC CAATCAACAT TTGTGTTATT CTTAGTTGCC TTTTTTCCCT CATATCAGTA
TGCACAAAAG GAAAATAGCA CTAGGTTTTT AAAAGTCCTC TTTTGTTTAG TGGTGTCTTG TTGGAGGGCA ACTCCAGAAA
GCAGTCTGAC ATGTTAACCA AAAAAGTAAA GATAAGTGGC TAGAGGTATG CCCAAATGCA GTATCTACAT ATATGGGGGG
ACAGGGGGTG CATGAAAAAT TGGAGAGTGC AATATCAAAC TTTCAGTTTT TAAAAGTGAC ACTGACACAA TTTCTATCAT
TTTTCAAGTT GACAGCACAT AACACATCAA ATAAAGCCAT CACCTTAAAT TTATTATACC CCTTTATTAA ACAGTCTAAA
CTTTATCTGT CACTAATCTT CTAAAGTAGT AATTTCTAAT TTCCAGTAGC ATACCTTATT ACCTTACCAT TCTCAAATCT
CAACTAAGTT ACCTGAAATA TCTGGTGGTT CTTTCTACAA TTTACAATTT GTAATTCACA AAAGCACCAA ATAAAGATTA
TTTTGATCTT AATTGATGAG TTAATCGATA CTTTTCTATT TATCTCAGGC AGGTTTTGGG ATTGCAACGG TGGGTTACAT
GTGCGTAATG TTCTCGGTGA CAACACCATT GGGAATACTT CTTGGAATGG CAATATTCCA TATGACTGGC TATGATGATA
GCAGTCCAAA TGCCCTAATA ATAGAAGGGC TCCTTGGCTC ACTTTCTTCT GGAATCCTTG TCTACATGGC ACTTGTCGAT
CTCATTTCTC TTGATTTCTT CCACAATAAA ATGATGTCAT CATCTAATAA ATTGAAAAAG GTCTCTTATG TCGCATTAGT
GCTTGGATCT GCATCCATGT CTATATTAGC TCTCTGGGCA TAGGTCATAG GTGCAACCAG AGTGAAATAC GGTGTATTGA
TCCTTTGTAG GAAGAAATGG ATGTTTTGGG AGTCAGGACT TCCCTCATGT AAATTAAACT TCCACATAAT GGGAAACTTA
AAAATTCTTG AATGCCT

Locus: Os05g0164800

Loading...

Locus: Os05g0164800

Loading...