Os05t0164800-02

Locus

Os05g0164800

Description

Similar to Zinc transporter 6, chloroplast precursor (ZRT/IRT-like protein 6).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ZIP6

CGSNL Gene Name

ZINC TRANSPORTER 6

Oryzabase Gene Symbol Synonym(s)

OsZIP6

Oryzabase Gene Name Synonym(s)

zinc transporter 6, Zrt-Irt-like protein 6, Zinc-regulated transporter 6

Transcript Evidence

AK103730 (DDBJ, Best hit)

Protein Evidence

Q6L8F9 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: metal ion transport (GO:0030001)

Biological Process: transmembrane transport (GO:0055085)

Biological Process: zinc ion transmembrane transport (GO:0071577)

Cellular Component: membrane (GO:0016020)

Cellular Component: integral to membrane (GO:0016021)

Molecular Function: zinc ion transmembrane transporter activity (GO:0005385)

Molecular Function: metal ion transmembrane transporter activity (GO:0046873)

Functional domain (InterPro)

Zinc/iron permease (IPR003689)

Zinc/iron permease, fungal/plant (IPR004698)

Full-length cDNA

J033138E20 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0164800-02)

RiceXPro (AK103730)

Others

Oryzabase (8377)

KEGG (Os05t0164800-02)

Transcript

1444 bp

>Os05t0164800-02 Similar to Zinc transporter 6, chloroplast precursor (ZRT/IRT-like protein 6).
CTCGCTCGCCGTCGCCGTCGCGGGAGACTCCGGCGAGCGCGTTGACGTGGCCATGTCGGG
GACGGGGTGCTTCCCGGCGGGGGAGATGGCGGCGGTGGCGAGGGTGTGCCGGGACGGGGC
GGCGGCGGCGAGGCTCAAGACGGGCTCCCTGCTCGCCATCCTCGTGGCGAGCGCCGTCGG
CATCTGCCTCCCCGTGGCGCTCACGGGGGCGTTCCGCGGGAAGGCCGGGTACGCGCGCGG
CCTCCTCCTCGTCAAGTGCTACGCCGCCGGGGTCATCCTCTCCACCTCGCTCGTCCACGT
CCTCCCCGACGCGCACGCCGCGCTCGCCGACTGCGCCGTCGCCACGCGCCGCCCGTGGCG
GGACTTCCCCTTCGCGGGCCTCTTCTCCCTCGTCGGCGCGCTCCTCGCCCTCCTCGTCGA
CCTCTCCGCCTCCTCCCACCTCGAAGCCCACGGCCACCACCAGCACGCGGAGGAGGGGGA
GTCGCCGCCGCCGCCGCCGCCGACCCACCAACCCTACGCCCCAATCCCCACCACCAAGAA
GTCCCCCGTCTTCGAGCTCTCCGGCGAGATGAGCCCCAAGAAGCGCGCGCACTCAGACGA
CACGGACCGGGACGACGTGGCGCTCTTCGGGGCCAAGAGCGCGGTCCGGAGCGACGAGGT
CGTCGTCGCCCCCCGTGTCGGCTGCCATGGGCACCACGACGTGGTGGAGGTTGGGGAGGA
AGGAGGAGGAGGGGAGGAGGAGGAGGCGAGGAGGAAGCAGAAGATGGTGTCCAAGGTGCT
CGAGATTGGGATCGTGTTCCACTCGGTCATCATCGGGGTCACCATGGGGATGTCTCAGGA
TGTCTGCGCCATCCGGCCGCTCGTCGTCGCGCTCTCCTTCCACCAGGTGTTCGAAGGAAT
GGGCCTCGGCGGCTGCATTGCGCAGGCAGGTTTTGGGATTGCAACGGTGGGTTACATGTG
CGTAATGTTCTCGGTGACAACACCATTGGGAATACTTCTTGGAATGGCAATATTCCATAT
GACTGGCTATGATGATAGCAGTCCAAATGCCCTAATAATAGAAGGGCTCCTTGGCTCACT
TTCTTCTGGAATCCTTGTCTACATGGCACTTGTCGATCTCATTTCTCTTGATTTCTTCCA
CAATAAAATGATGTCATCATCTAATAAATTGAAAAAGGTCTCTTATGTCGCATTAGTGCT
TGGATCTGCATCCATGTCTATATTAGCTCTCTGGGCATAGGTCATAGGTGCAACCAGAGT
GAAATACGGTGTATTGATCCTTTGTAGGAAGAAATGGATGTTTTGGGAGTCAGGACTTCC
CTCATGTAAATTAAACTTCCACATAATGGGAAACTTAAAAATTCTTGAATGCCTTTTGAT
ACTGTGAGCCATTTTCGTCTCCTGATTACCATGGACAATCAAAACGTACAGTGATTTATC
TTTC

CDS

1188 bp

>Os05t0164800-02 Similar to Zinc transporter 6, chloroplast precursor (ZRT/IRT-like protein 6).
ATGTCGGGGACGGGGTGCTTCCCGGCGGGGGAGATGGCGGCGGTGGCGAGGGTGTGCCGG
GACGGGGCGGCGGCGGCGAGGCTCAAGACGGGCTCCCTGCTCGCCATCCTCGTGGCGAGC
GCCGTCGGCATCTGCCTCCCCGTGGCGCTCACGGGGGCGTTCCGCGGGAAGGCCGGGTAC
GCGCGCGGCCTCCTCCTCGTCAAGTGCTACGCCGCCGGGGTCATCCTCTCCACCTCGCTC
GTCCACGTCCTCCCCGACGCGCACGCCGCGCTCGCCGACTGCGCCGTCGCCACGCGCCGC
CCGTGGCGGGACTTCCCCTTCGCGGGCCTCTTCTCCCTCGTCGGCGCGCTCCTCGCCCTC
CTCGTCGACCTCTCCGCCTCCTCCCACCTCGAAGCCCACGGCCACCACCAGCACGCGGAG
GAGGGGGAGTCGCCGCCGCCGCCGCCGCCGACCCACCAACCCTACGCCCCAATCCCCACC
ACCAAGAAGTCCCCCGTCTTCGAGCTCTCCGGCGAGATGAGCCCCAAGAAGCGCGCGCAC
TCAGACGACACGGACCGGGACGACGTGGCGCTCTTCGGGGCCAAGAGCGCGGTCCGGAGC
GACGAGGTCGTCGTCGCCCCCCGTGTCGGCTGCCATGGGCACCACGACGTGGTGGAGGTT
GGGGAGGAAGGAGGAGGAGGGGAGGAGGAGGAGGCGAGGAGGAAGCAGAAGATGGTGTCC
AAGGTGCTCGAGATTGGGATCGTGTTCCACTCGGTCATCATCGGGGTCACCATGGGGATG
TCTCAGGATGTCTGCGCCATCCGGCCGCTCGTCGTCGCGCTCTCCTTCCACCAGGTGTTC
GAAGGAATGGGCCTCGGCGGCTGCATTGCGCAGGCAGGTTTTGGGATTGCAACGGTGGGT
TACATGTGCGTAATGTTCTCGGTGACAACACCATTGGGAATACTTCTTGGAATGGCAATA
TTCCATATGACTGGCTATGATGATAGCAGTCCAAATGCCCTAATAATAGAAGGGCTCCTT
GGCTCACTTTCTTCTGGAATCCTTGTCTACATGGCACTTGTCGATCTCATTTCTCTTGAT
TTCTTCCACAATAAAATGATGTCATCATCTAATAAATTGAAAAAGGTCTCTTATGTCGCA
TTAGTGCTTGGATCTGCATCCATGTCTATATTAGCTCTCTGGGCATAG

Protein

396 aa

>Os05t0164800-02 Similar to Zinc transporter 6, chloroplast precursor (ZRT/IRT-like protein 6).
MSGTGCFPAGEMAAVARVCRDGAAAARLKTGSLLAILVASAVGICLPVALTGAFRGKAGY
ARGLLLVKCYAAGVILSTSLVHVLPDAHAALADCAVATRRPWRDFPFAGLFSLVGALLAL
LVDLSASSHLEAHGHHQHAEEGESPPPPPPTHQPYAPIPTTKKSPVFELSGEMSPKKRAH
SDDTDRDDVALFGAKSAVRSDEVVVAPRVGCHGHHDVVEVGEEGGGGEEEEARRKQKMVS
KVLEIGIVFHSVIIGVTMGMSQDVCAIRPLVVALSFHQVFEGMGLGGCIAQAGFGIATVG
YMCVMFSVTTPLGILLGMAIFHMTGYDDSSPNALIIEGLLGSLSSGILVYMALVDLISLD
FFHNKMMSSSNKLKKVSYVALVLGSASMSILALWA*

5'UTR

chr05:3810701..3810752 (- strand) : 52 bp

CDS

chr05:3809828..3810700 (- strand) : 873 bp

chr05:3808178..3808492 (- strand) : 315 bp

3'UTR

chr05:3807974..3808177 (- strand) : 204 bp

FASTA

>Os05t0164800-02 class=Sequence position=chr05:3807974..3810752 (- strand)
CTCGCTCGCC GTCGCCGTCG CGGGAGACTC CGGCGAGCGC GTTGACGTGG CCATGTCGGG GACGGGGTGC TTCCCGGCGG
GGGAGATGGC GGCGGTGGCG AGGGTGTGCC GGGACGGGGC GGCGGCGGCG AGGCTCAAGA CGGGCTCCCT GCTCGCCATC
CTCGTGGCGA GCGCCGTCGG CATCTGCCTC CCCGTGGCGC TCACGGGGGC GTTCCGCGGG AAGGCCGGGT ACGCGCGCGG
CCTCCTCCTC GTCAAGTGCT ACGCCGCCGG GGTCATCCTC TCCACCTCGC TCGTCCACGT CCTCCCCGAC GCGCACGCCG
CGCTCGCCGA CTGCGCCGTC GCCACGCGCC GCCCGTGGCG GGACTTCCCC TTCGCGGGCC TCTTCTCCCT CGTCGGCGCG
CTCCTCGCCC TCCTCGTCGA CCTCTCCGCC TCCTCCCACC TCGAAGCCCA CGGCCACCAC CAGCACGCGG AGGAGGGGGA
GTCGCCGCCG CCGCCGCCGC CGACCCACCA ACCCTACGCC CCAATCCCCA CCACCAAGAA GTCCCCCGTC TTCGAGCTCT
CCGGCGAGAT GAGCCCCAAG AAGCGCGCGC ACTCAGACGA CACGGACCGG GACGACGTGG CGCTCTTCGG GGCCAAGAGC
GCGGTCCGGA GCGACGAGGT CGTCGTCGCC CCCCGTGTCG GCTGCCATGG GCACCACGAC GTGGTGGAGG TTGGGGAGGA
AGGAGGAGGA GGGGAGGAGG AGGAGGCGAG GAGGAAGCAG AAGATGGTGT CCAAGGTGCT CGAGATTGGG ATCGTGTTCC
ACTCGGTCAT CATCGGGGTC ACCATGGGGA TGTCTCAGGA TGTCTGCGCC ATCCGGCCGC TCGTCGTCGC GCTCTCCTTC
CACCAGGTGT TCGAAGGAAT GGGCCTCGGC GGCTGCATTG CGCAGGTAAG CGAAATCCAT CTACCTGACT GCCTTCAATT
ACACCGTTCA TGATCGAATT CCATGGATCA ATTGTTATGA CCATAGTGGT TTTGGCTTGA ATCATGATCG AATTCCGTGA
ATCGATAGCT GTTACCGGAG TGGTTTTCGC TTGAATCATG ATCGAATTCC GTGAATCGAT AGCTGTTACC GGAGTGGTTC
TTTGCTTGAA TTGCTTCTTA GAATTAATAA TTAAAGAGTG CAGCAAAGCA AACTAGCTAG GACTTGTCAA AGCAGTTTTG
TGGCTTTCAG TGTGCGTTTC AGTGTTTTAG TAGTATGAAT CGCTCATGCC ACTGTCGCCT GTCATATTGA CTTGTTTAGT
TTAAAATAAA CATAGGTGTT ATAATATGTG ATTAGCTACC AATGCTTGCA CATAAGCAGT ACACGTGATT GTTACTGTAT
AATCTGTTTG TCCCAGATTA GGCCTTACTG CTGTTATTAT CGTTTAAAAT TCAGAGATGA AAGGCGCTAT ATACCAATAT
CACCATGCCA GGTGCTGAAT GATAGAAAGT GATTTATTAA CCCCCCTTTG CACCCCCTGA AGTATTTCTG TAACTTTGGA
ATGGTTCTTG GTGGAAACCT GCAAGGATCC CTGTTGTACA CCACTAGCAA CTGGAACCTA GTCACCATAT GACTATAACA
TATACTTTAG CAGTGAAAGT ATCCATGTCA GAATCTTTTA CACATCTAAA TCCATGATCT GTCCAATTTT GTTCATCCAC
GCCAATCAAC ATTTGTGTTA TTCTTAGTTG CCTTTTTTCC CTCATATCAG TATGCACAAA AGGAAAATAG CACTAGGTTT
TTAAAAGTCC TCTTTTGTTT AGTGGTGTCT TGTTGGAGGG CAACTCCAGA AAGCAGTCTG ACATGTTAAC CAAAAAAGTA
AAGATAAGTG GCTAGAGGTA TGCCCAAATG CAGTATCTAC ATATATGGGG GGACAGGGGG TGCATGAAAA ATTGGAGAGT
GCAATATCAA ACTTTCAGTT TTTAAAAGTG ACACTGACAC AATTTCTATC ATTTTTCAAG TTGACAGCAC ATAACACATC
AAATAAAGCC ATCACCTTAA ATTTATTATA CCCCTTTATT AAACAGTCTA AACTTTATCT GTCACTAATC TTCTAAAGTA
GTAATTTCTA ATTTCCAGTA GCATACCTTA TTACCTTACC ATTCTCAAAT CTCAACTAAG TTACCTGAAA TATCTGGTGG
TTCTTTCTAC AATTTACAAT TTGTAATTCA CAAAAGCACC AAATAAAGAT TATTTTGATC TTAATTGATG AGTTAATCGA
TACTTTTCTA TTTATCTCAG GCAGGTTTTG GGATTGCAAC GGTGGGTTAC ATGTGCGTAA TGTTCTCGGT GACAACACCA
TTGGGAATAC TTCTTGGAAT GGCAATATTC CATATGACTG GCTATGATGA TAGCAGTCCA AATGCCCTAA TAATAGAAGG
GCTCCTTGGC TCACTTTCTT CTGGAATCCT TGTCTACATG GCACTTGTCG ATCTCATTTC TCTTGATTTC TTCCACAATA
AAATGATGTC ATCATCTAAT AAATTGAAAA AGGTCTCTTA TGTCGCATTA GTGCTTGGAT CTGCATCCAT GTCTATATTA
GCTCTCTGGG CATAGGTCAT AGGTGCAACC AGAGTGAAAT ACGGTGTATT GATCCTTTGT AGGAAGAAAT GGATGTTTTG
GGAGTCAGGA CTTCCCTCAT GTAAATTAAA CTTCCACATA ATGGGAAACT TAAAAATTCT TGAATGCCTT TTGATACTGT
GAGCCATTTT CGTCTCCTGA TTACCATGGA CAATCAAAAC GTACAGTGAT TTATCTTTC

Locus: Os05g0164800

Loading...

Locus: Os05g0164800

Loading...