Os05t0170000-01

Locus

Os05g0170000

Description

Glycosyltransferase, Golgi-localized DUF266-containing protein, Putative beta-1,6-N-acetylglucosaminyltransferase, Cell-wall biosynthesis, Regulation of the cell wall polymers

RAP-DB Gene Symbol Synonym(s)

BC10, FC116, FC116/BC10

RAP-DB Gene Name Synonym(s)

brittle culm 10, fragile culm 116

CGSNL Gene Symbol

BC10

CGSNL Gene Name

BRITTLE CULM 10

Oryzabase Gene Symbol Synonym(s)

BC10, bc10, FC116, FC116/BC10, Osbc10, Osfc116

Oryzabase Gene Name Synonym(s)

brittle culm 10, fragile culm 116

Transcript Evidence

AK103412

Protein Evidence

Q65XS5

Literature

PMID: 27708650

PMID: 18939965

Note

Manual Curation

August 4, 2020

Gene Ontology (GO)

Molecular Function: acetylglucosaminyltransferase activity (GO:0008375)

Cellular Component: membrane (GO:0016020)

Functional domain (InterPro)

Glycosyl transferase, family 14 (IPR003406)

Experimentally confirmed subcellular location

Golgi apparatus (GO:0005794)

Full-length cDNA

J033128G01 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0170000-01)

RiceXPro (AK103412)

Others

Oryzabase (8281)

KEGG (Os05t0170000-01)

Transcript

1664 bp

>Os05t0170000-01 Glycosyltransferase, Golgi-localized DUF266-containing protein, Putative beta-1,6-N-acetylglucosaminyltransferase, Cell-wall biosynthesis, Regulation of the cell wall polymers
GCCGCGCTTGCTCGGCACGGCAACCCACGCGAAATCGGAGATTCCTTCGATTCACGAGAT
CACCACGAGTCCACCACCCTCCTCCTCTCGCTGGATTCGATGGGCGCTCGGTGAGATCCG
AATCCCCCACGGTGGTCGCCGGAGATGAAGCCGCCGCGGAGGTGGATGTACGGGCGGGGC
GGCGGGAAGGGGAAGCCGGCGGGGCTGCTGCTGCTGGGGGTGTTCCTCTGCTTGTCGGTG
GTGCTGCTGCTGCTGCTGCACGGCTCGTCCCCGTCGCTGGAGGGCGAGGGGAGGAAGCCT
GAGGCGGTGGAGGCGGCGGGGGGAGGGGGAGAGGAGGAGGAGGTGGCGGTGGCGCGGGCG
GAGGTGGAGGAGGCGCCGCTGCCGCCGGGGAACGCGCGGCTCGCCTTCCTCTTCATCGCC
CGCAACCGCCTCCCGCTCGACCTCGTCTGGGACGCCTTCTTCCGCGGTGACAAGGAAGGG
AGATTCTCCATCTTCGTGCACTCGCGGCCGGGGTTCGTGCTCACCCGCGCCACCACCCGA
TCCGGCTTCTTCTACAATCGGCAGGTCAACAACAGCGTCCAGGTGGATTGGGGGGAGGCG
AGCATGATCGAGGCTGAGCGTGTTCTACTCGCCCACGCGCTCAAGGACCCCTTAAACGAG
CGCTTCGTGTTCGTCTCCGACAGCTGTGTGCCATTGTACAACTTCAACTACACTTACGAC
TACATAATGTCTTCGTCAACCAGTTTTGTTGACAGTTTTGCTGATACAAAAGCGGGTCGG
TATAATCCCAGAATGGACCCAATTATCCCAGTGGAAAATTGGAGAAAAGGCTCGCAGTGG
GCTGTGTTAACAAGAAAACATGCTGAAGTTGTGGTTGAAGATGAAGAGGTTTTGCCAGAA
TTCCAGAAGCATTGCAGGAGAAGGCCCTTACCAGAGTTCTGGCGGGACTGGGATCGTCCT
ATTCCTGCGGAGGCATGGAAGGCACATAACTGCATACCAGATGAGCACTATGTTCAAACA
TTGCTTGCACAACATGGTCTTGAAGAAGAGCTTACACGGAGGTCAGTTACACACAGTGCG
TGGGATCTATCATCTTCTAAAGATCGTGAAAGGCGTGGATGGCATCCTGTAACATACAAA
ATCTCAGATGCTACTCCTGCACTTGTAAAATCCATAAAGGATATTGATAATATATATTAT
GAGACTGAAAATAGAAAGGAGTGGTGTACAAGTAATGGAAAACCAGCACCTTGCTTCCTT
TTTGCAAGGAAGTTTACACGAGCAGCTGGTCTGAAGCTTCTTGATTTATCTTTGATAGCA
GCAAATGGCGCATCTACCATGTAAAGTTTCTCCGTCAAAAGCAGAATACTGCCAGCTTGC
ACATACGTAAAGGAAAGTGGTGGAGGGGACAGAAGATAACAGCGAATTTTTTTTGGGCAT
CTTCATTACAATTTGTTGCACTCTGAAAAGGGACATAGGTGTTCTAAAGCAATAAAGTTT
GTTTCTTTTAGCACCTAGGTTAGTACATATGTTAACCCACTACTTAGCATTATAACTGTA
ACTGTAAGCAACCACCTGCAGTTGGATTGGCAAGAATCACCTCAGTTCTTTTCACGACAA
ATTCCTTTTTCAAATTTATAGAGAATTGGCATGTCTTATACTTG

CDS

1200 bp

>Os05t0170000-01 Glycosyltransferase, Golgi-localized DUF266-containing protein, Putative beta-1,6-N-acetylglucosaminyltransferase, Cell-wall biosynthesis, Regulation of the cell wall polymers
ATGAAGCCGCCGCGGAGGTGGATGTACGGGCGGGGCGGCGGGAAGGGGAAGCCGGCGGGG
CTGCTGCTGCTGGGGGTGTTCCTCTGCTTGTCGGTGGTGCTGCTGCTGCTGCTGCACGGC
TCGTCCCCGTCGCTGGAGGGCGAGGGGAGGAAGCCTGAGGCGGTGGAGGCGGCGGGGGGA
GGGGGAGAGGAGGAGGAGGTGGCGGTGGCGCGGGCGGAGGTGGAGGAGGCGCCGCTGCCG
CCGGGGAACGCGCGGCTCGCCTTCCTCTTCATCGCCCGCAACCGCCTCCCGCTCGACCTC
GTCTGGGACGCCTTCTTCCGCGGTGACAAGGAAGGGAGATTCTCCATCTTCGTGCACTCG
CGGCCGGGGTTCGTGCTCACCCGCGCCACCACCCGATCCGGCTTCTTCTACAATCGGCAG
GTCAACAACAGCGTCCAGGTGGATTGGGGGGAGGCGAGCATGATCGAGGCTGAGCGTGTT
CTACTCGCCCACGCGCTCAAGGACCCCTTAAACGAGCGCTTCGTGTTCGTCTCCGACAGC
TGTGTGCCATTGTACAACTTCAACTACACTTACGACTACATAATGTCTTCGTCAACCAGT
TTTGTTGACAGTTTTGCTGATACAAAAGCGGGTCGGTATAATCCCAGAATGGACCCAATT
ATCCCAGTGGAAAATTGGAGAAAAGGCTCGCAGTGGGCTGTGTTAACAAGAAAACATGCT
GAAGTTGTGGTTGAAGATGAAGAGGTTTTGCCAGAATTCCAGAAGCATTGCAGGAGAAGG
CCCTTACCAGAGTTCTGGCGGGACTGGGATCGTCCTATTCCTGCGGAGGCATGGAAGGCA
CATAACTGCATACCAGATGAGCACTATGTTCAAACATTGCTTGCACAACATGGTCTTGAA
GAAGAGCTTACACGGAGGTCAGTTACACACAGTGCGTGGGATCTATCATCTTCTAAAGAT
CGTGAAAGGCGTGGATGGCATCCTGTAACATACAAAATCTCAGATGCTACTCCTGCACTT
GTAAAATCCATAAAGGATATTGATAATATATATTATGAGACTGAAAATAGAAAGGAGTGG
TGTACAAGTAATGGAAAACCAGCACCTTGCTTCCTTTTTGCAAGGAAGTTTACACGAGCA
GCTGGTCTGAAGCTTCTTGATTTATCTTTGATAGCAGCAAATGGCGCATCTACCATGTAA

Protein

400 aa

>Os05t0170000-01 Glycosyltransferase, Golgi-localized DUF266-containing protein, Putative beta-1,6-N-acetylglucosaminyltransferase, Cell-wall biosynthesis, Regulation of the cell wall polymers
MKPPRRWMYGRGGGKGKPAGLLLLGVFLCLSVVLLLLLHGSSPSLEGEGRKPEAVEAAGG
GGEEEEVAVARAEVEEAPLPPGNARLAFLFIARNRLPLDLVWDAFFRGDKEGRFSIFVHS
RPGFVLTRATTRSGFFYNRQVNNSVQVDWGEASMIEAERVLLAHALKDPLNERFVFVSDS
CVPLYNFNYTYDYIMSSSTSFVDSFADTKAGRYNPRMDPIIPVENWRKGSQWAVLTRKHA
EVVVEDEEVLPEFQKHCRRRPLPEFWRDWDRPIPAEAWKAHNCIPDEHYVQTLLAQHGLE
EELTRRSVTHSAWDLSSSKDRERRGWHPVTYKISDATPALVKSIKDIDNIYYETENRKEW
CTSNGKPAPCFLFARKFTRAAGLKLLDLSLIAANGASTM*

5'UTR

chr05:4200307..4200450 (- strand) : 144 bp

CDS

chr05:4199986..4200306 (- strand) : 321 bp

chr05:4199747..4199863 (- strand) : 117 bp

chr05:4199530..4199630 (- strand) : 101 bp

chr05:4198628..4198699 (- strand) : 72 bp

chr05:4198259..4198340 (- strand) : 82 bp

chr05:4198079..4198159 (- strand) : 81 bp

chr05:4197181..4197225 (- strand) : 45 bp

chr05:4196839..4196904 (- strand) : 66 bp

chr05:4196602..4196751 (- strand) : 150 bp

chr05:4196100..4196228 (- strand) : 129 bp

chr05:4195928..4195963 (- strand) : 36 bp

3'UTR

chr05:4195608..4195927 (- strand) : 320 bp

FASTA

>Os05t0170000-01 class=Sequence position=chr05:4195608..4200450 (- strand)
GCCGCGCTTG CTCGGCACGG CAACCCACGC GAAATCGGAG ATTCCTTCGA TTCACGAGAT CACCACGAGT CCACCACCCT
CCTCCTCTCG CTGGATTCGA TGGGCGCTCG GTGAGATCCG AATCCCCCAC GGTGGTCGCC GGAGATGAAG CCGCCGCGGA
GGTGGATGTA CGGGCGGGGC GGCGGGAAGG GGAAGCCGGC GGGGCTGCTG CTGCTGGGGG TGTTCCTCTG CTTGTCGGTG
GTGCTGCTGC TGCTGCTGCA CGGCTCGTCC CCGTCGCTGG AGGGCGAGGG GAGGAAGCCT GAGGCGGTGG AGGCGGCGGG
GGGAGGGGGA GAGGAGGAGG AGGTGGCGGT GGCGCGGGCG GAGGTGGAGG AGGCGCCGCT GCCGCCGGGG AACGCGCGGC
TCGCCTTCCT CTTCATCGCC CGCAACCGCC TCCCGCTCGA CCTCGTCTGG GACGCCTTCT TCCGCGTAAG CGCGCGCCTC
GCCCGGATCT CCCCCTTCCT CTCGCTCTTG CTCGGATGGC TCCCAATTTC AGCGAATGCT GGTTTAATTT GAATCCTGAT
TGCATTGCGT TTTTTGGGGG TGAGTAGGGT GACAAGGAAG GGAGATTCTC CATCTTCGTG CACTCGCGGC CGGGGTTCGT
GCTCACCCGC GCCACCACCC GATCCGGCTT CTTCTACAAT CGGCAGGTCA ACAACAGCGT CCAGGTTCGC GACCTCGTCC
CCACTTCCGT TGGCAATGTG ATGTGATCCG TCGGTAGCAG CATCCGTTGC AGTCCACACT GGGTTCCTGA TGAGTTGGGC
ATGTGTGATT TGTCCTTCAG GTGGATTGGG GGGAGGCGAG CATGATCGAG GCTGAGCGTG TTCTACTCGC CCACGCGCTC
AAGGACCCCT TAAACGAGCG CTTCGTGTTC GTCTCCGACA GGTATGGATT ATGGAATTAT GATGTGTGCT AGTGTGTATG
CTTGGATAAA GTATTACTGA CTTTAGATAC TAAGTTGATT GGCACAAAAT TTTGGCAATG CCCAAAAAAT TTAGTCATGT
GTTCTGTTTA TAGCCAAAAA TTAAGCACTA CTAAATTATT TGTCTTGGTT GAATAGCAAA TGCAAGTTTA GTAGAAGCAA
ATGAATGCCT AGCCAGTTTT TGCCAGAAAA TTTGGCAATG GCCAGTTCTT GCCATTGCCA AAAAAATTGG TAAGGCTATG
AACCAAAACA AGCCCTAACT GCAATCTGTG TTGGCTTAAT CTCTTGTTCA GCACAATGTG TTGTTTCTAG GTTCTGATCA
TAATGAATTA AGGGAATGTT CCTGAACATA ATGATATGTC CTTACATTTT TATAAATGTG GACTGTTATC TAGTAAAGAT
TGTTTGTTTT TTTTAATCAT CGTTTGGCTA ACTAATTTTT TTTTCCAATA TGCAATGCTC AGATGATAAG TAGTTTCTGT
CCGCGATTTT AAGCTCATGC TAAAAATGTG GTGCGATAGC AGTCCTCAAT CTTAAATTCC ATGGAAATGA ATCTTGTGTT
ATACTGTTAG TCTGTTTCTA TTAAGTTTAA CGGGACTCCA CATGAAGCTG TACTGAATTT ACCAGATGCC TTGGTGCAAT
TTTAGGTATC GTTTACACGG TTGTTTTTCT GACAGCTCCA AATTTGAACT TAGTACTACA CATCTTTTTT TATAATCTTA
CAAAGCTCGT TGTTGCACCA TTTTGGATCT TAATTGGATT CATGCTTACT AGGATCTTCT CTCTCTGCCA GCTGTGTGCC
ATTGTACAAC TTCAACTACA CTTACGACTA CATAATGTCT TCGTCAACCA GTTTTGTTGA CAGGTATAGG CATCACAATT
TCGTGTTGTG TTTCCTGATG ATGGTTAAGA CTTAAGAATG AATTCTGAGT TCATGACAAG TATCAGCTAG TAACTATGAA
TGTTAAAGAA AAGAAAGAAA AAAAATCATG TTAGCCTTTC TCATTTTCCA TTATCTAAGT ATTTCCATGT ACCTTGAGCT
TCAAAATGGT TCCTGTAGCA AACTGCAGAT TTGCAGCTTA AAGCACCTTT CATTTAGCTT GTATAATATC CTGGGTATTA
ACAGCATCCA ATTGCATATG CTGGGGACAG TTTTGCTGAT ACAAAAGCGG GTCGGTATAA TCCCAGAATG GACCCAATTA
TCCCAGTGGA AAATTGGAGA AAAGGCTCGC AGGTACCTTT CTGTTTCTAT TGATGAAAGA TAGGAGAATT TTGCTTGAAC
TGTGTAACAG TTAGTTTTGA TACCTTATCA CCATTCATTT GTGCCATACA GTGGGCTGTG TTAACAAGAA AACATGCTGA
AGTTGTGGTT GAAGATGAAG AGGTTTTGCC AGAATTCCAG AAGCATTGCA GGGTATGTGA CTCAATATTT ATGCACTCTA
TGCAGATAAA TTTCAGTATT GTATAACATA GTTTACTCAT GATCATAACT GACCAGTGAA CTTTTTCACC TTGTACCTTT
CATCAAATTA AAATCAGGAT AACAGAAGTT GAAAATTTGA ATATTATCAA TATTTACTTT TTTATGACAG TTTTTTGCAT
TCGCAAGTGA ATGTGCTCTC AAGATAATCA ACATAGGACA CAAAGAAACT TGTAGATTTA TGTAAACTGC CACGTATGGT
ACTGACATTC TGACAATGTT TACGACAATG CATGATATCA GTGATTTATT TTATTTTATT TTTTAAACCT TTTTAATTTT
TATTTTTAAA AATAAATCAT TCGAAAACTT ATTTCCAAGA TCTAAACCTT TTGGCCGTAG TTGGTTGGCA AAACAACATT
GCCACACCGG TCTGGCTGGC ATGGCAGCGT TGTCTTGCCA CACCACCGTG GCTGGCAGGA CAAAACTGTC ACGCCCGTTG
CGGGTGAcgt gtcagtgttg ttttgtcaca ccaggcaggc tagcttggct aaaaggttca gattttggaa atattgtaaa
atTGTCATGC CCATTGCGGG TGACGTGTCA GTGTTGTTTT GTCACGCCAG GTGGGCTAGC TTGGCCAAAA GGTTCAGATT
TTAAAATTAA AAAGGTTAAA AAAATAAAAT AATTCGATAC TAGTACCTTT GCCAAATGAA TAGAAGATCC ACCGGATTTT
TCTATATCAT CAACCCAAGT TACTTAACTC ATGTCTCTTT CCTATCAATT AGCTTAGAGT TGTCTATTCT TGTTCCTATT
AAATGTACCT TTTTATTTAT TGCAGAGAAG GCCCTTACCA GAGTTCTGGC GGGACTGGGA TCGTCCTATT GTAAGTGAAA
GTCTCCAATA AAATACTGAA CTGTCACTTA GCTTGTTGAA CTTGCTTTTA TGTGTTTATT TTTGAACTGC AGCTGGCACA
TTGAGTATAA TAATCACAAC TCTTGTGCTA TTTCTTGTAC TCCATAAAAA GCTTAATTAA CAGAATTATT ATCTATGGCT
TCAAAATTTA CCACTGAACT CTATATCTCT ATCTAATTGC TCTACTGTTC CAGAACAAAG TTTAATTAGT AATTCTGTGA
GACTAAATGC TGCTCATTTT ATCCAGCCTG CGGAGGCATG GAAGGCACAT AACTGCATAC CAGATGAGCA CTATGTTCAA
ACATTGCTTG CAGTAAGTCA ACAATCATTT ACAGTATCCC TTGCAGCTGT TCCTCCTCAC AAAGACATCT GACCGTTCAA
TTATTTTTAT CGAATGCAGC AACATGGTCT TGAAGAAGAG CTTACACGGA GGTCAGTTAC ACACAGTGCG TGGGATCTAT
CATCTTCTAA AGATCGTGAA AGGCGTGGAT GGCATCCTGT AACATACAAA ATCTCAGATG CTACTCCTGC ACTTGTAAAA
TCCATAAAGG TATATGTTTC TTTGCAATGG CACATTTTTT GTTACCTGAA AGTGGTGATT ATATAGTATG TACATTTAAA
AAGGAAATTA AGAGAGGCTT TACTTTTTTT TCTTTTATTT GAAAATTCTG TCATTATTAA AATATTTAAG TACAAAGCAA
CAACCAAGGT GAATGTTGGA ACCTCTGTTG GGTAATGGCA GACGCTATCA ATTCATCTGT TTCAAAGCTT TAACAAATGT
CAGTTTGGAA ATGTGTTGCG TCTGATAAGG AATGTCAGCT TTTGTTTGTC ATGTATACAG TTCTGCCAAA ACAAGCTGCC
CGTACGAAAT GCACATGACA TTTTCTAACT ATTCACTGAG TACCTATTTG TTGAATTTTT AGGATATTGA TAATATATAT
TATGAGACTG AAAATAGAAA GGAGTGGTGT ACAAGTAATG GAAAACCAGC ACCTTGCTTC CTTTTTGCAA GGAAGTTTAC
ACGAGCAGCT GGTCTGAAGC TTCTTGATTT AGTAAGTTCA GGACCTTTAG CTTTTCATTT CATATCGTGA TGCAAACACA
GGCATTCCTA AACCTAATGT ATTGTCTAAC GAAATCACAT TGTGATTTGC TTATAGTTTT TGCTCTCTCC AAATTTCCCT
TTTGCAGTCT TTGATAGCAG CAAATGGCGC ATCTACCATG TAAAGTTTCT CCGTCAAAAG CAGAATACTG CCAGCTTGCA
CATACGTAAA GGAAAGTGGT GGAGGGGACA GAAGATAACA GCGAATTTTT TTTGGGCATC TTCATTACAA TTTGTTGCAC
TCTGAAAAGG GACATAGGTG TTCTAAAGCA ATAAAGTTTG TTTCTTTTAG CACCTAGGTT AGTACATATG TTAACCCACT
ACTTAGCATT ATAACTGTAA CTGTAAGCAA CCACCTGCAG TTGGATTGGC AAGAATCACC TCAGTTCTTT TCACGACAAA
TTCCTTTTTC AAATTTATAG AGAATTGGCA TGTCTTATAC TTG

Locus: Os05g0170000

Loading...

Locus: Os05g0170000

Loading...