Os05t0170000-02

Locus

Os05g0170000

Description

Protein of unknown function DUF266, plant family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

BC10

CGSNL Gene Name

BRITTLE CULM 10

Oryzabase Gene Symbol Synonym(s)

BC10, bc10, FC116, FC116/BC10, Osbc10, Osfc116

Oryzabase Gene Name Synonym(s)

brittle culm 10, fragile culm 116

Transcript Evidence

AK100216 (DDBJ, Best hit)

Protein Evidence

B8AYP5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: membrane (GO:0016020)

Molecular Function: acetylglucosaminyltransferase activity (GO:0008375)

Functional domain (InterPro)

Glycosyl transferase, family 14 (IPR003406)

Full-length cDNA

J023045H21 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0170000-02)

RiceXPro (AK100216)

Others

Oryzabase (8281)

KEGG (Os05t0170000-02)

Transcript

1905 bp

>Os05t0170000-02 Protein of unknown function DUF266, plant family protein.
GCTGGATTCGATGGGCGCTCGGTGAGATCCGAATCCCCCACGGTGGTCGCCGGAGATGAA
GCCGCCGCGGAGGTGGATGTACGGGCGGGGCGGCGGGAAGGGGAAGCCGGCGGGGCTGCT
GCTGCTGGGGGTGTTCCTCTGCTTGTCGGTGGTGCTGCTGCTGCTGCTGCACGGCTCGTC
CCCGTCGCTGGAGGGCGAGGGGAGGAAGCCTGAGGCGGTGGAGGCGGCGGGGGGAGGGGG
AGAGGAGGAGGAGGTGGCGGTGGCGCGGGCGGAGGTGGAGGAGGCGCCGCTGCCGCCGGG
GAACGCGCGGCTCGCCTTCCTCTTCATCGCCCGCAACCGCCTCCCGCTCGACCTCGTCTG
GGACGCCTTCTTCCGCGGTGACAAGGAAGGGAGATTCTCCATCTTCGTGCACTCGCGGCC
GGGGTTCGTGCTCACCCGCGCCACCACCCGATCCGGCTTCTTCTACAATCGGCAGGTCAA
CAACAGCGTCCAGGTGGATTGGGGGGAGGCGAGCATGATCGAGGCTGAGCGTGTTCTACT
CGCCCACGCGCTCAAGGACCCCTTAAACGAGCGCTTCGTGTTCGTCTCCGACAGCTGTGT
GCCATTGTACAACTTCAACTACACTTACGACTACATAATGTCTTCGTCAACCAGTTTTGT
TGACAGTTTTGCTGATACAAAAGCGGGTCGGTATAATCCCAGAATGGACCCAATTATCCC
AGTGGAAAATTGGAGAAAAGGCTCGCAGTGGGCTGTGTTAACAAGAAAACATGCTGAAGT
TGTGGTTGAAGATGAAGAGGTTTTGCCAGAATTCCAGAAGCATTGCAGGAGAAGGCCCTT
ACCAGAGTTCTGGCGGGACTGGGATCGTCCTATTCCTGCGGAGGCATGGAAGGCACATAA
CTGCATACCAGATGAGCACTATGTTCAAACATTGCTTGCACAACATGGTCTTGAAGAAGA
GCTTACACGGAGGTCAGTTACACACAGTGCGTGGGATCTATCATCTTCTAAAGATCGTGA
AAGGCGTGGATGGCATCCTGTAACATACAAAATCTCAGATGCTACTCCTGCACTTGTAAA
ATCCATAAAGGATATTGATAATATATATTATGAGACTGAAAATAGAAAGGAGTGGTGTAC
AAGTAATGGAAAACCAGCACCTTGCTTCCTTTTTGCAAGGAAGTTTACACGAGCAGCTGG
TCTGAAGCTTCTTGATTTATCTTTGATAGCAGCAAATGGCGCATCTACCATGTAAAGTTT
CTCCGTCAAAAGCAGAATACTGCCAGCTTGCACATACGTAAAGGAAAGTGGTGGAGGGGA
CAGAAGATAACAGCGAATTTTTTTTGGGCATCTTCATTACAATTTGTTGCACTCTGAAAA
GGGACATAGGTGTTCTAAAGCAATAAAGTTTGTTTCTTTTAGCACCTAGGTTAGTACATA
TGTTAACCCACTACTTAGCATTATAACTGTAACTGTAAGCAACCACCTGCAGTTGGATTG
GCAAGAATCACCTCAGTTCTTTTCACGACAAATTCCTTTTTCAAATTTATAGAGAATTGG
CATGTCTTATACTTGCATGCATACTGTAGTCATTCCATCGAAGGCAATGCGTGATCTGGT
TACCCAAACATTAATCAAGCATGTTGAACTCAGGAACTGCGTATTTCACATGGATTTATA
CTCTCATAGCAGATCTGCCGATCAACATGCATGTTTGGCATTCTGTTCCATCAGAAACAT
GGGACCCTAGTGCCGTGGCAATGGTTATCCCCTACCCTTAGGACCTTTGGACTTTTGATG
GCCTCAATTTAAAACTGTGCTGGCTGGAGATGCAGCGATGGTGTAGCCAATTCAATGATT
CTCATCATTGTTGTTCCTCCAATTGATGTGTTACTTCTTGTACTC

CDS

1200 bp

>Os05t0170000-02 Protein of unknown function DUF266, plant family protein.
ATGAAGCCGCCGCGGAGGTGGATGTACGGGCGGGGCGGCGGGAAGGGGAAGCCGGCGGGG
CTGCTGCTGCTGGGGGTGTTCCTCTGCTTGTCGGTGGTGCTGCTGCTGCTGCTGCACGGC
TCGTCCCCGTCGCTGGAGGGCGAGGGGAGGAAGCCTGAGGCGGTGGAGGCGGCGGGGGGA
GGGGGAGAGGAGGAGGAGGTGGCGGTGGCGCGGGCGGAGGTGGAGGAGGCGCCGCTGCCG
CCGGGGAACGCGCGGCTCGCCTTCCTCTTCATCGCCCGCAACCGCCTCCCGCTCGACCTC
GTCTGGGACGCCTTCTTCCGCGGTGACAAGGAAGGGAGATTCTCCATCTTCGTGCACTCG
CGGCCGGGGTTCGTGCTCACCCGCGCCACCACCCGATCCGGCTTCTTCTACAATCGGCAG
GTCAACAACAGCGTCCAGGTGGATTGGGGGGAGGCGAGCATGATCGAGGCTGAGCGTGTT
CTACTCGCCCACGCGCTCAAGGACCCCTTAAACGAGCGCTTCGTGTTCGTCTCCGACAGC
TGTGTGCCATTGTACAACTTCAACTACACTTACGACTACATAATGTCTTCGTCAACCAGT
TTTGTTGACAGTTTTGCTGATACAAAAGCGGGTCGGTATAATCCCAGAATGGACCCAATT
ATCCCAGTGGAAAATTGGAGAAAAGGCTCGCAGTGGGCTGTGTTAACAAGAAAACATGCT
GAAGTTGTGGTTGAAGATGAAGAGGTTTTGCCAGAATTCCAGAAGCATTGCAGGAGAAGG
CCCTTACCAGAGTTCTGGCGGGACTGGGATCGTCCTATTCCTGCGGAGGCATGGAAGGCA
CATAACTGCATACCAGATGAGCACTATGTTCAAACATTGCTTGCACAACATGGTCTTGAA
GAAGAGCTTACACGGAGGTCAGTTACACACAGTGCGTGGGATCTATCATCTTCTAAAGAT
CGTGAAAGGCGTGGATGGCATCCTGTAACATACAAAATCTCAGATGCTACTCCTGCACTT
GTAAAATCCATAAAGGATATTGATAATATATATTATGAGACTGAAAATAGAAAGGAGTGG
TGTACAAGTAATGGAAAACCAGCACCTTGCTTCCTTTTTGCAAGGAAGTTTACACGAGCA
GCTGGTCTGAAGCTTCTTGATTTATCTTTGATAGCAGCAAATGGCGCATCTACCATGTAA

Protein

400 aa

>Os05t0170000-02 Protein of unknown function DUF266, plant family protein.
MKPPRRWMYGRGGGKGKPAGLLLLGVFLCLSVVLLLLLHGSSPSLEGEGRKPEAVEAAGG
GGEEEEVAVARAEVEEAPLPPGNARLAFLFIARNRLPLDLVWDAFFRGDKEGRFSIFVHS
RPGFVLTRATTRSGFFYNRQVNNSVQVDWGEASMIEAERVLLAHALKDPLNERFVFVSDS
CVPLYNFNYTYDYIMSSSTSFVDSFADTKAGRYNPRMDPIIPVENWRKGSQWAVLTRKHA
EVVVEDEEVLPEFQKHCRRRPLPEFWRDWDRPIPAEAWKAHNCIPDEHYVQTLLAQHGLE
EELTRRSVTHSAWDLSSSKDRERRGWHPVTYKISDATPALVKSIKDIDNIYYETENRKEW
CTSNGKPAPCFLFARKFTRAAGLKLLDLSLIAANGASTM*

5'UTR

chr05:4200307..4200361 (- strand) : 55 bp

CDS

chr05:4199986..4200306 (- strand) : 321 bp

chr05:4199747..4199863 (- strand) : 117 bp

chr05:4199530..4199630 (- strand) : 101 bp

chr05:4198628..4198699 (- strand) : 72 bp

chr05:4198259..4198340 (- strand) : 82 bp

chr05:4198079..4198159 (- strand) : 81 bp

chr05:4197181..4197225 (- strand) : 45 bp

chr05:4196839..4196904 (- strand) : 66 bp

chr05:4196602..4196751 (- strand) : 150 bp

chr05:4196100..4196228 (- strand) : 129 bp

chr05:4195928..4195963 (- strand) : 36 bp

3'UTR

chr05:4195278..4195927 (- strand) : 650 bp

FASTA

>Os05t0170000-02 class=Sequence position=chr05:4195278..4200361 (- strand)
GCTGGATTCG ATGGGCGCTC GGTGAGATCC GAATCCCCCA CGGTGGTCGC CGGAGATGAA GCCGCCGCGG AGGTGGATGT
ACGGGCGGGG CGGCGGGAAG GGGAAGCCGG CGGGGCTGCT GCTGCTGGGG GTGTTCCTCT GCTTGTCGGT GGTGCTGCTG
CTGCTGCTGC ACGGCTCGTC CCCGTCGCTG GAGGGCGAGG GGAGGAAGCC TGAGGCGGTG GAGGCGGCGG GGGGAGGGGG
AGAGGAGGAG GAGGTGGCGG TGGCGCGGGC GGAGGTGGAG GAGGCGCCGC TGCCGCCGGG GAACGCGCGG CTCGCCTTCC
TCTTCATCGC CCGCAACCGC CTCCCGCTCG ACCTCGTCTG GGACGCCTTC TTCCGCGTAA GCGCGCGCCT CGCCCGGATC
TCCCCCTTCC TCTCGCTCTT GCTCGGATGG CTCCCAATTT CAGCGAATGC TGGTTTAATT TGAATCCTGA TTGCATTGCG
TTTTTTGGGG GTGAGTAGGG TGACAAGGAA GGGAGATTCT CCATCTTCGT GCACTCGCGG CCGGGGTTCG TGCTCACCCG
CGCCACCACC CGATCCGGCT TCTTCTACAA TCGGCAGGTC AACAACAGCG TCCAGGTTCG CGACCTCGTC CCCACTTCCG
TTGGCAATGT GATGTGATCC GTCGGTAGCA GCATCCGTTG CAGTCCACAC TGGGTTCCTG ATGAGTTGGG CATGTGTGAT
TTGTCCTTCA GGTGGATTGG GGGGAGGCGA GCATGATCGA GGCTGAGCGT GTTCTACTCG CCCACGCGCT CAAGGACCCC
TTAAACGAGC GCTTCGTGTT CGTCTCCGAC AGGTATGGAT TATGGAATTA TGATGTGTGC TAGTGTGTAT GCTTGGATAA
AGTATTACTG ACTTTAGATA CTAAGTTGAT TGGCACAAAA TTTTGGCAAT GCCCAAAAAA TTTAGTCATG TGTTCTGTTT
ATAGCCAAAA ATTAAGCACT ACTAAATTAT TTGTCTTGGT TGAATAGCAA ATGCAAGTTT AGTAGAAGCA AATGAATGCC
TAGCCAGTTT TTGCCAGAAA ATTTGGCAAT GGCCAGTTCT TGCCATTGCC AAAAAAATTG GTAAGGCTAT GAACCAAAAC
AAGCCCTAAC TGCAATCTGT GTTGGCTTAA TCTCTTGTTC AGCACAATGT GTTGTTTCTA GGTTCTGATC ATAATGAATT
AAGGGAATGT TCCTGAACAT AATGATATGT CCTTACATTT TTATAAATGT GGACTGTTAT CTAGTAAAGA TTGTTTGTTT
TTTTTAATCA TCGTTTGGCT AACTAATTTT TTTTTCCAAT ATGCAATGCT CAGATGATAA GTAGTTTCTG TCCGCGATTT
TAAGCTCATG CTAAAAATGT GGTGCGATAG CAGTCCTCAA TCTTAAATTC CATGGAAATG AATCTTGTGT TATACTGTTA
GTCTGTTTCT ATTAAGTTTA ACGGGACTCC ACATGAAGCT GTACTGAATT TACCAGATGC CTTGGTGCAA TTTTAGGTAT
CGTTTACACG GTTGTTTTTC TGACAGCTCC AAATTTGAAC TTAGTACTAC ACATCTTTTT TTATAATCTT ACAAAGCTCG
TTGTTGCACC ATTTTGGATC TTAATTGGAT TCATGCTTAC TAGGATCTTC TCTCTCTGCC AGCTGTGTGC CATTGTACAA
CTTCAACTAC ACTTACGACT ACATAATGTC TTCGTCAACC AGTTTTGTTG ACAGGTATAG GCATCACAAT TTCGTGTTGT
GTTTCCTGAT GATGGTTAAG ACTTAAGAAT GAATTCTGAG TTCATGACAA GTATCAGCTA GTAACTATGA ATGTTAAAGA
AAAGAAAGAA AAAAAATCAT GTTAGCCTTT CTCATTTTCC ATTATCTAAG TATTTCCATG TACCTTGAGC TTCAAAATGG
TTCCTGTAGC AAACTGCAGA TTTGCAGCTT AAAGCACCTT TCATTTAGCT TGTATAATAT CCTGGGTATT AACAGCATCC
AATTGCATAT GCTGGGGACA GTTTTGCTGA TACAAAAGCG GGTCGGTATA ATCCCAGAAT GGACCCAATT ATCCCAGTGG
AAAATTGGAG AAAAGGCTCG CAGGTACCTT TCTGTTTCTA TTGATGAAAG ATAGGAGAAT TTTGCTTGAA CTGTGTAACA
GTTAGTTTTG ATACCTTATC ACCATTCATT TGTGCCATAC AGTGGGCTGT GTTAACAAGA AAACATGCTG AAGTTGTGGT
TGAAGATGAA GAGGTTTTGC CAGAATTCCA GAAGCATTGC AGGGTATGTG ACTCAATATT TATGCACTCT ATGCAGATAA
ATTTCAGTAT TGTATAACAT AGTTTACTCA TGATCATAAC TGACCAGTGA ACTTTTTCAC CTTGTACCTT TCATCAAATT
AAAATCAGGA TAACAGAAGT TGAAAATTTG AATATTATCA ATATTTACTT TTTTATGACA GTTTTTTGCA TTCGCAAGTG
AATGTGCTCT CAAGATAATC AACATAGGAC ACAAAGAAAC TTGTAGATTT ATGTAAACTG CCACGTATGG TACTGACATT
CTGACAATGT TTACGACAAT GCATGATATC AGTGATTTAT TTTATTTTAT TTTTTAAACC TTTTTAATTT TTATTTTTAA
AAATAAATCA TTCGAAAACT TATTTCCAAG ATCTAAACCT TTTGGCCGTA GTTGGTTGGC AAAACAACAT TGCCACACCG
GTCTGGCTGG CATGGCAGCG TTGTCTTGCC ACACCACCGT GGCTGGCAGG ACAAAACTGT CACGCCCGTT GCGGGTGAcg
tgtcagtgtt gttttgtcac accaggcagg ctagcttggc taaaaggttc agattttgga aatattgtaa aatTGTCATG
CCCATTGCGG GTGACGTGTC AGTGTTGTTT TGTCACGCCA GGTGGGCTAG CTTGGCCAAA AGGTTCAGAT TTTAAAATTA
AAAAGGTTAA AAAAATAAAA TAATTCGATA CTAGTACCTT TGCCAAATGA ATAGAAGATC CACCGGATTT TTCTATATCA
TCAACCCAAG TTACTTAACT CATGTCTCTT TCCTATCAAT TAGCTTAGAG TTGTCTATTC TTGTTCCTAT TAAATGTACC
TTTTTATTTA TTGCAGAGAA GGCCCTTACC AGAGTTCTGG CGGGACTGGG ATCGTCCTAT TGTAAGTGAA AGTCTCCAAT
AAAATACTGA ACTGTCACTT AGCTTGTTGA ACTTGCTTTT ATGTGTTTAT TTTTGAACTG CAGCTGGCAC ATTGAGTATA
ATAATCACAA CTCTTGTGCT ATTTCTTGTA CTCCATAAAA AGCTTAATTA ACAGAATTAT TATCTATGGC TTCAAAATTT
ACCACTGAAC TCTATATCTC TATCTAATTG CTCTACTGTT CCAGAACAAA GTTTAATTAG TAATTCTGTG AGACTAAATG
CTGCTCATTT TATCCAGCCT GCGGAGGCAT GGAAGGCACA TAACTGCATA CCAGATGAGC ACTATGTTCA AACATTGCTT
GCAGTAAGTC AACAATCATT TACAGTATCC CTTGCAGCTG TTCCTCCTCA CAAAGACATC TGACCGTTCA ATTATTTTTA
TCGAATGCAG CAACATGGTC TTGAAGAAGA GCTTACACGG AGGTCAGTTA CACACAGTGC GTGGGATCTA TCATCTTCTA
AAGATCGTGA AAGGCGTGGA TGGCATCCTG TAACATACAA AATCTCAGAT GCTACTCCTG CACTTGTAAA ATCCATAAAG
GTATATGTTT CTTTGCAATG GCACATTTTT TGTTACCTGA AAGTGGTGAT TATATAGTAT GTACATTTAA AAAGGAAATT
AAGAGAGGCT TTACTTTTTT TTCTTTTATT TGAAAATTCT GTCATTATTA AAATATTTAA GTACAAAGCA ACAACCAAGG
TGAATGTTGG AACCTCTGTT GGGTAATGGC AGACGCTATC AATTCATCTG TTTCAAAGCT TTAACAAATG TCAGTTTGGA
AATGTGTTGC GTCTGATAAG GAATGTCAGC TTTTGTTTGT CATGTATACA GTTCTGCCAA AACAAGCTGC CCGTACGAAA
TGCACATGAC ATTTTCTAAC TATTCACTGA GTACCTATTT GTTGAATTTT TAGGATATTG ATAATATATA TTATGAGACT
GAAAATAGAA AGGAGTGGTG TACAAGTAAT GGAAAACCAG CACCTTGCTT CCTTTTTGCA AGGAAGTTTA CACGAGCAGC
TGGTCTGAAG CTTCTTGATT TAGTAAGTTC AGGACCTTTA GCTTTTCATT TCATATCGTG ATGCAAACAC AGGCATTCCT
AAACCTAATG TATTGTCTAA CGAAATCACA TTGTGATTTG CTTATAGTTT TTGCTCTCTC CAAATTTCCC TTTTGCAGTC
TTTGATAGCA GCAAATGGCG CATCTACCAT GTAAAGTTTC TCCGTCAAAA GCAGAATACT GCCAGCTTGC ACATACGTAA
AGGAAAGTGG TGGAGGGGAC AGAAGATAAC AGCGAATTTT TTTTGGGCAT CTTCATTACA ATTTGTTGCA CTCTGAAAAG
GGACATAGGT GTTCTAAAGC AATAAAGTTT GTTTCTTTTA GCACCTAGGT TAGTACATAT GTTAACCCAC TACTTAGCAT
TATAACTGTA ACTGTAAGCA ACCACCTGCA GTTGGATTGG CAAGAATCAC CTCAGTTCTT TTCACGACAA ATTCCTTTTT
CAAATTTATA GAGAATTGGC ATGTCTTATA CTTGCATGCA TACTGTAGTC ATTCCATCGA AGGCAATGCG TGATCTGGTT
ACCCAAACAT TAATCAAGCA TGTTGAACTC AGGAACTGCG TATTTCACAT GGATTTATAC TCTCATAGCA GATCTGCCGA
TCAACATGCA TGTTTGGCAT TCTGTTCCAT CAGAAACATG GGACCCTAGT GCCGTGGCAA TGGTTATCCC CTACCCTTAG
GACCTTTGGA CTTTTGATGG CCTCAATTTA AAACTGTGCT GGCTGGAGAT GCAGCGATGG TGTAGCCAAT TCAATGATTC
TCATCATTGT TGTTCCTCCA ATTGATGTGT TACTTCTTGT ACTC

Locus: Os05g0170000

Loading...

Locus: Os05g0170000

Loading...