Os05t0170950-00

Locus

Os05g0170950

Description

Similar to Plastid phosphoenolpyruvate/phosphate translocator.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PPT4

CGSNL Gene Name

PHOSPHOENOLPYRUVATE/PHOSPHATE TRANSLOCATOR 4

Oryzabase Gene Symbol Synonym(s)

OsPPT4

Oryzabase Gene Name Synonym(s)

Transcript Evidence

CT836467 (DDBJ, Best hit)

Protein Evidence

Q5VQL3 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Domain of unknown function DUF250 (IPR004853)

Expression Databases

TENOR (Os05t0170950-00)

Others

Oryzabase (8718)

KEGG (Os05t0170950-00)

Transcript

586 bp

>Os05t0170950-00 Similar to Plastid phosphoenolpyruvate/phosphate translocator.
GTGTTTGGGCTGTTCTGTATTATCTTTGCTAACCAATGTTTTATTCAAACACTGTCTTTT
TGGGCATGTAGGGAGTTAATCTACAGGAACTATGTATGAAAGCTGCTCTTGCTGGCACTT
GTTTTCATTTTTACCAACAGGTTTCTTATAGTTTATTGGCTAGAGTATCACCTGTGACCC
ATTCTGTTGCCAACTGTGTCAAACGAGTTGTGGTCATCGTCTCATCCGTTCTCTTCTTCA
GAACTCCGATTTCACCTATTAATGCCCTTGGAACTGGCGTTGCTCTAGCTGGAGTTTTCC
TGTACTCTAGGTTCAAAAAAGCTAAACCAAAGGCTAAGACTGCATGAGTCAACATACACA
GCTGCAATTTAACTAGAAGATTCAGGTTTATCTCTTCTTGAGGTGAAATGGGCCGCCAAG
CAATCACTTGGCTTCTCTCCAATTTGTCTTTTGCCAGCTTGTCTGGGTCTTAGAAGCTTG
TGTATAAGATTTTTCTCAGGAAGGTAGTGATGGACCGGCACCAAAATAACAAAATAACAT
TGTCAGAAGATTTCTCAAGAGAAATGAATTTTGGCACATACTTTTG

CDS

276 bp

>Os05t0170950-00 Similar to Plastid phosphoenolpyruvate/phosphate translocator.
GGAGTTAATCTACAGGAACTATGTATGAAAGCTGCTCTTGCTGGCACTTGTTTTCATTTT
TACCAACAGGTTTCTTATAGTTTATTGGCTAGAGTATCACCTGTGACCCATTCTGTTGCC
AACTGTGTCAAACGAGTTGTGGTCATCGTCTCATCCGTTCTCTTCTTCAGAACTCCGATT
TCACCTATTAATGCCCTTGGAACTGGCGTTGCTCTAGCTGGAGTTTTCCTGTACTCTAGG
TTCAAAAAAGCTAAACCAAAGGCTAAGACTGCATGA

Protein

92 aa

>Os05t0170950-00 Similar to Plastid phosphoenolpyruvate/phosphate translocator.
GVNLQELCMKAALAGTCFHFYQQVSYSLLARVSPVTHSVANCVKRVVVIVSSVLFFRTPI
SPINALGTGVALAGVFLYSRFKKAKPKAKTA*

5'UTR

chr05:4254052..4254122 (+ strand) : 71 bp

CDS

chr05:4254123..4254191 (+ strand) : 69 bp

chr05:4254408..4254537 (+ strand) : 130 bp

chr05:4254624..4254700 (+ strand) : 77 bp

3'UTR

chr05:4254701..4254939 (+ strand) : 239 bp

FASTA

>Os05t0170950-00 class=Sequence position=chr05:4254052..4254939 (+ strand)
GTGTTTGGGC TGTTCTGTAT TATCTTTGCT AACCAATGTT TTATTCAAAC ACTGTCTTTT TGGGCATGTA GGGAGTTAAT
CTACAGGAAC TATGTATGAA AGCTGCTCTT GCTGGCACTT GTTTTCATTT TTACCAACAG GTGGGCTAAA TTCCAGTATA
AAAATAGTTT TTATGGTTGT CCAACGGTTC TTAGAATTTT GTAGTAATTT TTATGGTTTG TCTGCATGGA TCCAAATTTT
CTAGTGGTGG CTAGTAATAC ATGAGTGTAT CTGCAAGTTT TTTTAATTAC CATGGTCAAT CTCTTTCGGA TTTTGTTTAA
TTACCTTAAC CAAAATTATT TTTGTTTCTG AGGCAGGTTT CTTATAGTTT ATTGGCTAGA GTATCACCTG TGACCCATTC
TGTTGCCAAC TGTGTCAAAC GAGTTGTGGT CATCGTCTCA TCCGTTCTCT TCTTCAGAAC TCCGATTTCA CCTATTAATG
CCCTTGGTAA CCTCACAACC AAATTCAACT GATCCTAACA GCTCGCTTTT CAATTTACCC GTACTGAATT TTGTCCTTTT
TTCTGCATTC AGGAACTGGC GTTGCTCTAG CTGGAGTTTT CCTGTACTCT AGGTTCAAAA AAGCTAAACC AAAGGCTAAG
ACTGCATGAG TCAACATACA CAGCTGCAAT TTAACTAGAA GATTCAGGTT TATCTCTTCT TGAGGTGAAA TGGGCCGCCA
AGCAATCACT TGGCTTCTCT CCAATTTGTC TTTTGCCAGC TTGTCTGGGT CTTAGAAGCT TGTGTATAAG ATTTTTCTCA
GGAAGGTAGT GATGGACCGG CACCAAAATA ACAAAATAAC ATTGTCAGAA GATTTCTCAA GAGAAATGAA TTTTGGCACA
TACTTTTG

Locus: Os05g0170950

Loading...

Locus: Os05g0170950

Loading...