Os05t0171000-01

Locus

Os05g0171000

Description

Phospholipase D2 (EC 3.1.4.4).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PLDalpha2

CGSNL Gene Name

PHOSPHOLIPASE D alpha 2

Oryzabase Gene Symbol Synonym(s)

OsPLDalpha2, OsC2DP43, C2DP43

Oryzabase Gene Name Synonym(s)

phospholipase Dalpha2, C2 Domain-Containing Protein 43

Transcript Evidence

AK240654 (DDBJ, Best hit)

Protein Evidence

A2Y0V0 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: metabolic process (GO:0008152)

Biological Process: phosphatidylcholine metabolic process (GO:0046470)

Cellular Component: membrane (GO:0016020)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: phospholipase D activity (GO:0004630)

Molecular Function: calcium ion binding (GO:0005509)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

C2 calcium-dependent membrane targeting (IPR000008)

Phospholipase D/Transphosphatidylase (IPR001736)

C2 calcium/lipid-binding domain, CaLB (IPR008973)

Phospholipase D, plant (IPR011402)

Phospholipase D (IPR015679)

Phospholipase D, C-terminal (IPR024632)

Full-length cDNA

J023098I11 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0171000-01)

Others

Oryzabase (8688)

KEGG (Os05t0171000-01 (EC:3.1.4.4))

Transcript

2720 bp

>Os05t0171000-01 Phospholipase D2 (EC 3.1.4.4).
GGGGTGATCATCGAGATCGTGTTGAGGGATAGATAGTTTAATCTAACAATGGCGAAGATC
CTGCTCCATGGGACGATGCACGTCACCATCTTCGAGGCGGAATCGCTCTCCAACCCTAGC
AGGCCAAGCTCCCAAGCGCCCCAGTTCCTCCGCAAGCTGGTGGAGGGGATCGAGGACACG
GTGGGCGTGGGCAAGGGGACGAGCAAGGTGTACGCCACCATCGGCCTCGACAAGGCCCGC
GTCGGccgcacccgcacgctcgccgacgacaccgccgcgccgcgctggtacgagtccttc
cacgtctactgcgcccacctcgccacccacgtcgccttcaccctcaaggccaagaacccc
atcggcgcctccctcctcggcgtcggctacctccccgtccgggacgtcctcGCCGGCGAC
GAGGTCGACCGCTGGCTCCCCCTCTGCGACGACACCGACGCGCGCACCCCCATCGGCGAC
GGCGGCGGCAAGGTCCACGTCAAGCTCCAGTACTTCGACATCTCCAAGGATCGGAGCTGG
GGCCGCGGCGTCCGCAGCGGCAAGTACCCCGGCGTGCCCTACACCTTCTTCTCGCAGCGG
CAAGGATGCAAGGTGACGTTGTACCAGGACGCCCATGTCCCCGACGGGTTCATCCCCCGG
ATCCCGCTCGACGGCGGCCGGAGCTACGAGCCGCACCGGTGCTGGGAGGACATCTTCGAC
GCCATCAATGGCGCGAGGCATTTTATCTATATCACTGGTTGGTCGGTGTACACGGAGATC
GCGCTGATCAGGGACGCCGACCGGCCGAAGCCCGGCGGCGGCGTGACGCTCGGCGAGCTG
CTGAAGAAGAAGGCCGGCGAGGGCGTGAGGGTGCTGATGCTGGTGTGGGACGACCGGACG
TCGGTGGGGATGCTCAAGAAGGACGGGCTCATGGCGACGCACGACGAGGAGACGATGAAC
TACTTCCAGGGCACGGAGGTGAACTGCGTGCTGTGCCCGCGCAACCCGGACGACTCCGGC
AGCATCGTGCAGGACCTGCAGATCTCCACCATGTTCACGCACCACCAGAAGATCGTCGTC
GTCGACCACGACATGCCGTCGTCGCGCCACGGCGGCGGCAATGGCGGCGGGCGGCGGAGG
GTGGTGAGCTTCGTCGGCGGGCTGGACCTCTGCGACGGGAGGTACGACACGCCGTTCCAC
TCGCTGTTCCGGACGCTGGGGACGGCGCACCACGACGACTTCCACCAGCCGAACTTCGCG
ACGGCGACGGTGGCCAAGGGCGGGCCGCGCGAGCCGTGGCACGACATCCACTGCCGCCTC
GAGGGCCCCGTGGCGTGGGACGTGCTCTACAACTTCGAGCAGCGGTGGCGCAAGCAGGGC
GGCAAGGACCTCCTCGTCCAGCTCCGGGACCTCGCCGAGACGGTCATCCCGCCGTCGCCG
GCGATGTTCCCGGAGGACGCCGAGTCGTGGAACGTGCAGCTGTTCCGCTCCATCGACGGC
GGCGCCGCGTTCGGCTTCCCGGACACCCCCGAGGACGCCGCCCGCGCCGGCCTCGTCAGC
GGCAAGGACCAGATCATCGACCGGAGCATCCAGGACGCCTACATCGCCGCCATTAGGAGG
GCGCGGAGCTTCATCTACATCGAGAACCAGTACTTCCTCGGGAGCTCCTACTGCTGGAAG
CCCAACGACGGCGTCAAGCCGGAAGATGTCGGCGCGCTCCACCTCATCCCCAAGGAGCTC
TCCATGAAGGTGGTGAGCAAGATCGAGGCCGGCGAGCGCTTCACCGTCTACGTCGTCGTG
CCGATGTGGCCGGAGGGCATCCCGGAGAGCGGCTCCGTCCAGGCCATCCTTGACTGGCAG
CGCCGCACTATGGAGATGATGTACACCGACATCGCCCACGCCATCCAGGCCAAGGGCATC
GACGCCGACCCCAAGGACTACCTCACCTTCTTCTGCCTCGGCAACCGCGAGGCCAAGTCC
GCCGGCGAGTACGAGCCACCGGAGCAGGCCGAGCCCGACACCGGCTACTTCCACGCGCAG
CAGAATCGCCGCTTCATGATCTACGTCCACACCAAGATGATGATCGtggacgacgagtac
atcatcgtcgggtcggcgaacatcaaccagaggtcgatggacggggcgagggactcggag
atcgccatgggagcgtaccagccgcaccacctggCGGCGGCGGGGCGGCCGGCGAGGGGG
CAGGTGCACGGGTTCAGGATGGCGCTGTGGTACGAGCACCTCGGTACCGTCGACGAGGCG
TTCCAGCGGCCGGAGAGCCTCGACTGCGTGCGCAAGGTGAACGCCATGGCGGACAGGTGC
TGGGACCTCTACGCCGGCGACGGGCCGGAGCGCGACCTCCCCGGCCACCTGCTCACCTAC
CCCGTCGGCGTCGCCGGCGACGGCACCATCACGCAGCTCCCCGGCGTGGAGTTCTTCCCG
GACACCCAGGCGCGGATCCTTGGCGCCAAATCCGACTACCTCCCGCCAATTTTGACCACT
TAAAGAAGAGCTAAATTAACCTCTCTGTGCGCTTTATCGTCAATGAGAAGAGATTTATTT
TGGTTTTTTTTACTTTTGAATAAGAACACCACACTAGTTTATGGCTTCTGTATTTATTTT
GGACAATAACAACTGCATTAATGCAGTGAAACATCATGATGAGTTGCTATTTGTTATGAC
AGATTTGCTAGTTTCACACT

CDS

2475 bp

>Os05t0171000-01 Phospholipase D2 (EC 3.1.4.4).
ATGGCGAAGATCCTGCTCCATGGGACGATGCACGTCACCATCTTCGAGGCGGAATCGCTC
TCCAACCCTAGCAGGCCAAGCTCCCAAGCGCCCCAGTTCCTCCGCAAGCTGGTGGAGGGG
ATCGAGGACACGGTGGGCGTGGGCAAGGGGACGAGCAAGGTGTACGCCACCATCGGCCTC
GACAAGGCCCGCGTCGGccgcacccgcacgctcgccgacgacaccgccgcgccgcgctgg
tacgagtccttccacgtctactgcgcccacctcgccacccacgtcgccttcaccctcaag
gccaagaaccccatcggcgcctccctcctcggcgtcggctacctccccgtccgggacgtc
ctcGCCGGCGACGAGGTCGACCGCTGGCTCCCCCTCTGCGACGACACCGACGCGCGCACC
CCCATCGGCGACGGCGGCGGCAAGGTCCACGTCAAGCTCCAGTACTTCGACATCTCCAAG
GATCGGAGCTGGGGCCGCGGCGTCCGCAGCGGCAAGTACCCCGGCGTGCCCTACACCTTC
TTCTCGCAGCGGCAAGGATGCAAGGTGACGTTGTACCAGGACGCCCATGTCCCCGACGGG
TTCATCCCCCGGATCCCGCTCGACGGCGGCCGGAGCTACGAGCCGCACCGGTGCTGGGAG
GACATCTTCGACGCCATCAATGGCGCGAGGCATTTTATCTATATCACTGGTTGGTCGGTG
TACACGGAGATCGCGCTGATCAGGGACGCCGACCGGCCGAAGCCCGGCGGCGGCGTGACG
CTCGGCGAGCTGCTGAAGAAGAAGGCCGGCGAGGGCGTGAGGGTGCTGATGCTGGTGTGG
GACGACCGGACGTCGGTGGGGATGCTCAAGAAGGACGGGCTCATGGCGACGCACGACGAG
GAGACGATGAACTACTTCCAGGGCACGGAGGTGAACTGCGTGCTGTGCCCGCGCAACCCG
GACGACTCCGGCAGCATCGTGCAGGACCTGCAGATCTCCACCATGTTCACGCACCACCAG
AAGATCGTCGTCGTCGACCACGACATGCCGTCGTCGCGCCACGGCGGCGGCAATGGCGGC
GGGCGGCGGAGGGTGGTGAGCTTCGTCGGCGGGCTGGACCTCTGCGACGGGAGGTACGAC
ACGCCGTTCCACTCGCTGTTCCGGACGCTGGGGACGGCGCACCACGACGACTTCCACCAG
CCGAACTTCGCGACGGCGACGGTGGCCAAGGGCGGGCCGCGCGAGCCGTGGCACGACATC
CACTGCCGCCTCGAGGGCCCCGTGGCGTGGGACGTGCTCTACAACTTCGAGCAGCGGTGG
CGCAAGCAGGGCGGCAAGGACCTCCTCGTCCAGCTCCGGGACCTCGCCGAGACGGTCATC
CCGCCGTCGCCGGCGATGTTCCCGGAGGACGCCGAGTCGTGGAACGTGCAGCTGTTCCGC
TCCATCGACGGCGGCGCCGCGTTCGGCTTCCCGGACACCCCCGAGGACGCCGCCCGCGCC
GGCCTCGTCAGCGGCAAGGACCAGATCATCGACCGGAGCATCCAGGACGCCTACATCGCC
GCCATTAGGAGGGCGCGGAGCTTCATCTACATCGAGAACCAGTACTTCCTCGGGAGCTCC
TACTGCTGGAAGCCCAACGACGGCGTCAAGCCGGAAGATGTCGGCGCGCTCCACCTCATC
CCCAAGGAGCTCTCCATGAAGGTGGTGAGCAAGATCGAGGCCGGCGAGCGCTTCACCGTC
TACGTCGTCGTGCCGATGTGGCCGGAGGGCATCCCGGAGAGCGGCTCCGTCCAGGCCATC
CTTGACTGGCAGCGCCGCACTATGGAGATGATGTACACCGACATCGCCCACGCCATCCAG
GCCAAGGGCATCGACGCCGACCCCAAGGACTACCTCACCTTCTTCTGCCTCGGCAACCGC
GAGGCCAAGTCCGCCGGCGAGTACGAGCCACCGGAGCAGGCCGAGCCCGACACCGGCTAC
TTCCACGCGCAGCAGAATCGCCGCTTCATGATCTACGTCCACACCAAGATGATGATCGtg
gacgacgagtacatcatcgtcgggtcggcgaacatcaaccagaggtcgatggacggggcg
agggactcggagatcgccatgggagcgtaccagccgcaccacctggCGGCGGCGGGGCGG
CCGGCGAGGGGGCAGGTGCACGGGTTCAGGATGGCGCTGTGGTACGAGCACCTCGGTACC
GTCGACGAGGCGTTCCAGCGGCCGGAGAGCCTCGACTGCGTGCGCAAGGTGAACGCCATG
GCGGACAGGTGCTGGGACCTCTACGCCGGCGACGGGCCGGAGCGCGACCTCCCCGGCCAC
CTGCTCACCTACCCCGTCGGCGTCGCCGGCGACGGCACCATCACGCAGCTCCCCGGCGTG
GAGTTCTTCCCGGACACCCAGGCGCGGATCCTTGGCGCCAAATCCGACTACCTCCCGCCA
ATTTTGACCACTTAA

Protein

824 aa

>Os05t0171000-01 Phospholipase D2 (EC 3.1.4.4).
MAKILLHGTMHVTIFEAESLSNPSRPSSQAPQFLRKLVEGIEDTVGVGKGTSKVYATIGL
DKARVGRTRTLADDTAAPRWYESFHVYCAHLATHVAFTLKAKNPIGASLLGVGYLPVRDV
LAGDEVDRWLPLCDDTDARTPIGDGGGKVHVKLQYFDISKDRSWGRGVRSGKYPGVPYTF
FSQRQGCKVTLYQDAHVPDGFIPRIPLDGGRSYEPHRCWEDIFDAINGARHFIYITGWSV
YTEIALIRDADRPKPGGGVTLGELLKKKAGEGVRVLMLVWDDRTSVGMLKKDGLMATHDE
ETMNYFQGTEVNCVLCPRNPDDSGSIVQDLQISTMFTHHQKIVVVDHDMPSSRHGGGNGG
GRRRVVSFVGGLDLCDGRYDTPFHSLFRTLGTAHHDDFHQPNFATATVAKGGPREPWHDI
HCRLEGPVAWDVLYNFEQRWRKQGGKDLLVQLRDLAETVIPPSPAMFPEDAESWNVQLFR
SIDGGAAFGFPDTPEDAARAGLVSGKDQIIDRSIQDAYIAAIRRARSFIYIENQYFLGSS
YCWKPNDGVKPEDVGALHLIPKELSMKVVSKIEAGERFTVYVVVPMWPEGIPESGSVQAI
LDWQRRTMEMMYTDIAHAIQAKGIDADPKDYLTFFCLGNREAKSAGEYEPPEQAEPDTGY
FHAQQNRRFMIYVHTKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLAAAGR
PARGQVHGFRMALWYEHLGTVDEAFQRPESLDCVRKVNAMADRCWDLYAGDGPERDLPGH
LLTYPVGVAGDGTITQLPGVEFFPDTQARILGAKSDYLPPILTT*

5'UTR

chr05:4260075..4260122 (- strand) : 48 bp

CDS

chr05:4259967..4260074 (- strand) : 108 bp

chr05:4256564..4258493 (- strand) : 1930 bp

chr05:4256046..4256482 (- strand) : 437 bp

3'UTR

chr05:4255849..4256045 (- strand) : 197 bp

FASTA

>Os05t0171000-01 class=Sequence position=chr05:4255849..4260122 (- strand)
GGGGTGATCA TCGAGATCGT GTTGAGGGAT AGATAGTTTA ATCTAACAAT GGCGAAGATC CTGCTCCATG GGACGATGCA
CGTCACCATC TTCGAGGCGG AATCGCTCTC CAACCCTAGC AGGCCAAGCT CCCAAGCGCC CCAGTTCCTC CGCAAGGTCC
TTTGCTTGTT CCTTCATCAT GGACTTACTT AGATCTCCCA TGCAGTATAT ACTTCCtcca tccctaaatg tttgacgccg
ttgacttttt taaacatgtt tgaccgttcg tcttattgaa aaaacttttg tgaaatatga cgaatggtca aacatgttta
aaaaagtcaa cggcgtcaaa tatttaagta aggagggagt aTATTATTTG CCGTATTGAT TTCAACTTTC AAGTCGTGTA
CAACGAACGA GTTGTCTAGT GTTTTACCCT GATCGTTTGA GACATGGCTG ATAAGTCATG GAAAAATGAG CGAAAGCAAC
CGAATATAAT TTATGGTGAT GATTTTAttt tatatatgtg tgttgtttgt gttttagaaa gcaatgctgg aaaatagact
ataatggaat aaaaactgaa atcaacgttt tataatttag attttagctg GTGCCTGTTT TAACAGTCAT AACCGGAAGT
GGTTCTTGCC ATCCATTCAT GCATGAACGT GATTTGCTCC TTTTGCTACA GTCCAATTCT ATTCCTTTTT TTTTTGCTAA
TCCTCTCTTC TCTCTTCTAT CCAATGGAAA TGTGTGCGGC GATATTCGAG TCATAATCAT ATTGAAATTA CCATCAGTAG
CATCATCATG TGCATACATT TTCAATCTAT AGGACGAGCT AGTCTacaaa catactccat ccgtcctaaa aaaaggcaaa
ccctaggttt gcgtgtccaa ctttgactgt ccgtcttata tgaaattttt ttataattat tatttttatt attgttagat
gataaaacat gattaatact ttgtgcgtga cttgtctttt taattttttt cataattttt tcaaataaga cgaacggtca
aacattgggc acggaaacca gggtttgtct ttttttggga cggagggatg ggaCGGAGGG AGTACTAGTG TTTTGTTGAA
ATTTATATTT TTCAAATCAA ATCAAAAAAT AGCTTGCAAT GCTTTGCCTC ggtaaactct tttgatccct cgagatgatg
tctcttgttt gtcaaaaacc cattcaaata attatgaaaa attcttttga caacattcat acagcatata tacaacactt
cacaaaatca acttacaaac tgagatataa aaaaagggtc aaatttaaat atCCTCACTC AGAATCTGTt actccctcca
tttctaaata tttgacacca ttgacttttt agcatatgtt tgaccgttcg tcttattcaa aaacttttat gaaatatgta
aaactatatg catatatata actatattta acaatgaatc aagtgatagg aaaagaatta ataattactt aattttttta
aataagataa actataaaac atatttaaaa aagtcaacgg cgtcaaatat ttagaaaact gtaggagtaC TGATGAAGCT
GCATTTGCAT TTGCGCGAAT GTGACGCAGC TGGTGGAGGG GATCGAGGAC ACGGTGGGCG TGGGCAAGGG GACGAGCAAG
GTGTACGCCA CCATCGGCCT CGACAAGGCC CGCGTCGGcc gcacccgcac gctcgccgac gacaccgccg cgccgcgctg
gtacgagtcc ttccacgtct actgcgccca cctcgccacc cacgtcgcct tcaccctcaa ggccaagaac cccatcggcg
cctccctcct cggcgtcggc tacctccccg tccgggacgt cctcGCCGGC GACGAGGTCG ACCGCTGGCT CCCCCTCTGC
GACGACACCG ACGCGCGCAC CCCCATCGGC GACGGCGGCG GCAAGGTCCA CGTCAAGCTC CAGTACTTCG ACATCTCCAA
GGATCGGAGC TGGGGCCGCG GCGTCCGCAG CGGCAAGTAC CCCGGCGTGC CCTACACCTT CTTCTCGCAG CGGCAAGGAT
GCAAGGTGAC GTTGTACCAG GACGCCCATG TCCCCGACGG GTTCATCCCC CGGATCCCGC TCGACGGCGG CCGGAGCTAC
GAGCCGCACC GGTGCTGGGA GGACATCTTC GACGCCATCA ATGGCGCGAG GCATTTTATC TATATCACTG GTTGGTCGGT
GTACACGGAG ATCGCGCTGA TCAGGGACGC CGACCGGCCG AAGCCCGGCG GCGGCGTGAC GCTCGGCGAG CTGCTGAAGA
AGAAGGCCGG CGAGGGCGTG AGGGTGCTGA TGCTGGTGTG GGACGACCGG ACGTCGGTGG GGATGCTCAA GAAGGACGGG
CTCATGGCGA CGCACGACGA GGAGACGATG AACTACTTCC AGGGCACGGA GGTGAACTGC GTGCTGTGCC CGCGCAACCC
GGACGACTCC GGCAGCATCG TGCAGGACCT GCAGATCTCC ACCATGTTCA CGCACCACCA GAAGATCGTC GTCGTCGACC
ACGACATGCC GTCGTCGCGC CACGGCGGCG GCAATGGCGG CGGGCGGCGG AGGGTGGTGA GCTTCGTCGG CGGGCTGGAC
CTCTGCGACG GGAGGTACGA CACGCCGTTC CACTCGCTGT TCCGGACGCT GGGGACGGCG CACCACGACG ACTTCCACCA
GCCGAACTTC GCGACGGCGA CGGTGGCCAA GGGCGGGCCG CGCGAGCCGT GGCACGACAT CCACTGCCGC CTCGAGGGCC
CCGTGGCGTG GGACGTGCTC TACAACTTCG AGCAGCGGTG GCGCAAGCAG GGCGGCAAGG ACCTCCTCGT CCAGCTCCGG
GACCTCGCCG AGACGGTCAT CCCGCCGTCG CCGGCGATGT TCCCGGAGGA CGCCGAGTCG TGGAACGTGC AGCTGTTCCG
CTCCATCGAC GGCGGCGCCG CGTTCGGCTT CCCGGACACC CCCGAGGACG CCGCCCGCGC CGGCCTCGTC AGCGGCAAGG
ACCAGATCAT CGACCGGAGC ATCCAGGACG CCTACATCGC CGCCATTAGG AGGGCGCGGA GCTTCATCTA CATCGAGAAC
CAGTACTTCC TCGGGAGCTC CTACTGCTGG AAGCCCAACG ACGGCGTCAA GCCGGAAGAT GTCGGCGCGC TCCACCTCAT
CCCCAAGGAG CTCTCCATGA AGGTGGTGAG CAAGATCGAG GCCGGCGAGC GCTTCACCGT CTACGTCGTC GTGCCGATGT
GGCCGGAGGG CATCCCGGAG AGCGGCTCCG TCCAGGCCAT CCTTGACTGG CAGCGCCGCA CTATGGAGAT GATGTACACC
GACATCGCCC ACGCCATCCA GGCCAAGGGC ATCGACGCCG ACCCCAAGGA CTACCTCACC TTCTTCTGCC TCGGCAACCG
CGAGGCCAAG TCCGCCGGCG AGTACGAGCC ACCGGAGCAG GCCGAGCCCG ACACCGGCTA CTTCCACGCG CAGCAGAATC
GCCGCTTCAT GATCTACGTC CACACCAAGA TGATGATCGG TTCGTATATA TCTCCTGATT GATCTTACCA CGATTGTTTT
TGGATGCATT TCTTGATCGA TTTGGTTGTG TGTTCATCAg tggacgacga gtacatcatc gtcgggtcgg cgaacatcaa
ccagaggtcg atggacgggg cgagggactc ggagatcgcc atgggagcgt accagccgca ccacctggCG GCGGCGGGGC
GGCCGGCGAG GGGGCAGGTG CACGGGTTCA GGATGGCGCT GTGGTACGAG CACCTCGGTA CCGTCGACGA GGCGTTCCAG
CGGCCGGAGA GCCTCGACTG CGTGCGCAAG GTGAACGCCA TGGCGGACAG GTGCTGGGAC CTCTACGCCG GCGACGGGCC
GGAGCGCGAC CTCCCCGGCC ACCTGCTCAC CTACCCCGTC GGCGTCGCCG GCGACGGCAC CATCACGCAG CTCCCCGGCG
TGGAGTTCTT CCCGGACACC CAGGCGCGGA TCCTTGGCGC CAAATCCGAC TACCTCCCGC CAATTTTGAC CACTTAAAGA
AGAGCTAAAT TAACCTCTCT GTGCGCTTTA TCGTCAATGA GAAGAGATTT ATTTTGGTTT TTTTTACTTT TGAATAAGAA
CACCACACTA GTTTATGGCT TCTGTATTTA TTTTGGACAA TAACAACTGC ATTAATGCAG TGAAACATCA TGATGAGTTG
CTATTTGTTA TGACAGATTT GCTAGTTTCA CACT

Locus: Os05g0171000

Loading...

Locus: Os05g0171000

Loading...