Os05t0178100-01

Locus

Os05g0178100

Description

GA 3beta-hydroxylase1, GA metabolism

RAP-DB Gene Symbol Synonym(s)

GA3OX1, OsGA3ox1, GA3ox1, OsGA3OX1

RAP-DB Gene Name Synonym(s)

GIBBERELLIN 3BETA-HYDROXYLASE 1, GA 3beta-hydroxylase1, GA 3beta-hydroxylase 1, Gibberellin(GA)-3 beta-hydroxylase-1

CGSNL Gene Symbol

GA3OX1

CGSNL Gene Name

GIBBERELLIN 3BETA-HYDROXYLASE 1

Oryzabase Gene Symbol Synonym(s)

OsGA3ox1, GA3ox1, OsGA3OX1

Oryzabase Gene Name Synonym(s)

GA 3beta-hydroxylase1, GA 3beta-hydroxylase 1, Gibberellin(GA)-3 beta-hydroxylase-1

Transcript Evidence

AB054084 (DDBJ)

AK120915 (DDBJ)

Protein Evidence

Q94IE3 (UniProt)

Q6AT12 (UniProt)

Literature

PMID: 11438692

PMID: 15075394

Note

Manual Curation

May 8, 2009

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors (GO:0016706)

Functional domain (InterPro)

Oxoglutarate/iron-dependent oxygenase (IPR005123)

Full-length cDNA

J023034H12 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0178100-01)

Others

Oryzabase (2278)

Transcript

1414 bp

>Os05t0178100-01 GA 3beta-hydroxylase1, GA metabolism
GTGCGTTAGCCAACGAGTTCATGCAGATCATGACATCGTCGTCGACCTCGCCGACCTCGC
CGACCTCGCCGCTGGCCGCCGCCGCCGACAATGGCGTCGCCGCCGCCTACTTCAACTTCC
GCGGGGCGGAGCGCGTGCCGGAGTCGCACGTGTGGAAGGGGATGCACGAGAAGGACACCG
CGCCGGTGGCGGCGGCGGACGCGGACGGCGGCGACGCGGTGCCGGTGGTGGACATGAGCG
GCGGCGACGACGCCGCGGTGGCGGCGGTGGCGCGCGCGGCGGAGGAGTGGGGCGGGTTCC
TGCTCGTCGGGCACGGCGTGACCGCGGAGGCCCTGGCGCGCGTCGAGGCGCAGGCGGCGC
GGCTGTTCGCGCTGCCGGCGGACGACAAGGCGCGCGGGGCGCGGCGGCCCGGCGGCGGGA
ACACCGGCTACGGCGTGCCGCCGTACCTCCTCCGGTACCCGAAGCAGATGTGGGCCGAGG
GCTACACCTTCCCTCCCCCTGCCATCCGCGACGAGTTCCGCCGCGTCTGGCCCGACGCCG
GCGACGACTACCACCGCTTCTGCTCCGCCATGGAGGAGTACGACTCGTCGATGAGAGCTC
TGGGCGAGAGGCTCCTCGCCATGTTCTTCAAGGCGCTCGGGCTCGCCGGCAACGATGCCC
CCGGCGGCGAGACCGAGCGGAAGATCCGCGAAACGTTGACGTCGACGATTCACCTCAACA
TGTTCCCTAGGTGTCCAGATCCAGACCGGGTGGTCGGGCTGGCGGCGCACACGGACTCAG
GCTTCTTCACCTTCATCCTGCAGAGCCCCGTGCCGGGGTTGCAGCTGCTCCGCCACCGGC
CGGACCGGTGGGTGACGGTTCCGGGGACGCCGGGGGCGCTCATCGTCGTCGTCGGCGATC
TCTTCCATGTGCTCACCAACGGGCGCTTCCACAGCGTGTTCCACCGCGCCGTCGTGAACC
GGGAGAGAGACCGGATCTCCATGCCCTACTTCCTCGGTCCGCCGGCCGACATGAAGGTGA
CACCTCTCGTGGCGGCGGGGTCGCCGGAGAGCAAGGCCGTGTATCAGGCCGTGACATGGC
CGGAGTACATGGCTGTAAGGGATAAGTTGTTCGGGACAAATATATCGGCGTTGAGCATGA
TTCGAGTAGCGAAGGAAGAGGACAAGGAGAGTTAGAACTATGGTATGATTGCAATTATCC
ATGCCAGAAAAAAAAAATTAGGGATATGATTTGTTGTGCTAAAATAAGGAAGGCAAATTT
TAATTATAAGCAAGTATAGGTAGTTTTCCCTTGAATAAACTTTTTTTCTTAACAGCTTTC
ATAAATTGGAAAGGTGAATACTGACCTGATGAGAGTTTCACTGTAGAACCAGGACAAGGA
ATAAGGAATAAGTTGAGGCAACCTGAACAATGCT

CDS

1146 bp

>Os05t0178100-01 GA 3beta-hydroxylase1, GA metabolism
ATGACATCGTCGTCGACCTCGCCGACCTCGCCGACCTCGCCGCTGGCCGCCGCCGCCGAC
AATGGCGTCGCCGCCGCCTACTTCAACTTCCGCGGGGCGGAGCGCGTGCCGGAGTCGCAC
GTGTGGAAGGGGATGCACGAGAAGGACACCGCGCCGGTGGCGGCGGCGGACGCGGACGGC
GGCGACGCGGTGCCGGTGGTGGACATGAGCGGCGGCGACGACGCCGCGGTGGCGGCGGTG
GCGCGCGCGGCGGAGGAGTGGGGCGGGTTCCTGCTCGTCGGGCACGGCGTGACCGCGGAG
GCCCTGGCGCGCGTCGAGGCGCAGGCGGCGCGGCTGTTCGCGCTGCCGGCGGACGACAAG
GCGCGCGGGGCGCGGCGGCCCGGCGGCGGGAACACCGGCTACGGCGTGCCGCCGTACCTC
CTCCGGTACCCGAAGCAGATGTGGGCCGAGGGCTACACCTTCCCTCCCCCTGCCATCCGC
GACGAGTTCCGCCGCGTCTGGCCCGACGCCGGCGACGACTACCACCGCTTCTGCTCCGCC
ATGGAGGAGTACGACTCGTCGATGAGAGCTCTGGGCGAGAGGCTCCTCGCCATGTTCTTC
AAGGCGCTCGGGCTCGCCGGCAACGATGCCCCCGGCGGCGAGACCGAGCGGAAGATCCGC
GAAACGTTGACGTCGACGATTCACCTCAACATGTTCCCTAGGTGTCCAGATCCAGACCGG
GTGGTCGGGCTGGCGGCGCACACGGACTCAGGCTTCTTCACCTTCATCCTGCAGAGCCCC
GTGCCGGGGTTGCAGCTGCTCCGCCACCGGCCGGACCGGTGGGTGACGGTTCCGGGGACG
CCGGGGGCGCTCATCGTCGTCGTCGGCGATCTCTTCCATGTGCTCACCAACGGGCGCTTC
CACAGCGTGTTCCACCGCGCCGTCGTGAACCGGGAGAGAGACCGGATCTCCATGCCCTAC
TTCCTCGGTCCGCCGGCCGACATGAAGGTGACACCTCTCGTGGCGGCGGGGTCGCCGGAG
AGCAAGGCCGTGTATCAGGCCGTGACATGGCCGGAGTACATGGCTGTAAGGGATAAGTTG
TTCGGGACAAATATATCGGCGTTGAGCATGATTCGAGTAGCGAAGGAAGAGGACAAGGAG
AGTTAG

Protein

382 aa

>Os05t0178100-01 GA 3beta-hydroxylase1, GA metabolism
MTSSSTSPTSPTSPLAAAADNGVAAAYFNFRGAERVPESHVWKGMHEKDTAPVAAADADG
GDAVPVVDMSGGDDAAVAAVARAAEEWGGFLLVGHGVTAEALARVEAQAARLFALPADDK
ARGARRPGGGNTGYGVPPYLLRYPKQMWAEGYTFPPPAIRDEFRRVWPDAGDDYHRFCSA
MEEYDSSMRALGERLLAMFFKALGLAGNDAPGGETERKIRETLTSTIHLNMFPRCPDPDR
VVGLAAHTDSGFFTFILQSPVPGLQLLRHRPDRWVTVPGTPGALIVVVGDLFHVLTNGRF
HSVFHRAVVNRERDRISMPYFLGPPADMKVTPLVAAGSPESKAVYQAVTWPEYMAVRDKL
FGTNISALSMIRVAKEEDKES*

5'UTR

chr05:4662537..4662565 (- strand) : 29 bp

CDS

chr05:4662004..4662536 (- strand) : 533 bp

chr05:4661746..4661904 (- strand) : 159 bp

chr05:4660901..4661354 (- strand) : 454 bp

3'UTR

chr05:4660662..4660900 (- strand) : 239 bp

FASTA

>Os05t0178100-01 class=Sequence position=chr05:4660662..4662565 (- strand)
GTGCGTTAGC CAACGAGTTC ATGCAGATCA TGACATCGTC GTCGACCTCG CCGACCTCGC CGACCTCGCC GCTGGCCGCC
GCCGCCGACA ATGGCGTCGC CGCCGCCTAC TTCAACTTCC GCGGGGCGGA GCGCGTGCCG GAGTCGCACG TGTGGAAGGG
GATGCACGAG AAGGACACCG CGCCGGTGGC GGCGGCGGAC GCGGACGGCG GCGACGCGGT GCCGGTGGTG GACATGAGCG
GCGGCGACGA CGCCGCGGTG GCGGCGGTGG CGCGCGCGGC GGAGGAGTGG GGCGGGTTCC TGCTCGTCGG GCACGGCGTG
ACCGCGGAGG CCCTGGCGCG CGTCGAGGCG CAGGCGGCGC GGCTGTTCGC GCTGCCGGCG GACGACAAGG CGCGCGGGGC
GCGGCGGCCC GGCGGCGGGA ACACCGGCTA CGGCGTGCCG CCGTACCTCC TCCGGTACCC GAAGCAGATG TGGGCCGAGG
GCTACACCTT CCCTCCCCCT GCCATCCGCG ACGAGTTCCG CCGCGTCTGG CCCGACGCCG GCGACGACTA CCACCGCTTC
TGGTACGCGT TTACCGCCGA TCGATCGATC GATCCGCCAT TGCTTGCATG CAACTAACCT AGCTAGCTTC CGCGCGTGTT
CGTCCGATCC GGCCCGGCCA GCTCCGCCAT GGAGGAGTAC GACTCGTCGA TGAGAGCTCT GGGCGAGAGG CTCCTCGCCA
TGTTCTTCAA GGCGCTCGGG CTCGCCGGCA ACGATGCCCC CGGCGGCGAG ACCGAGCGGA AGATCCGCGA AACGTTGACG
TCGACGATTC ACCTCAACAT GTATGTAAAC TCATATGGAT GTGGATTTTC TATGCATAGA TGCCATAGCA CTGCACCCAT
Catttacata cgattttgag aaaatataag tttataaaca agctatattt aatctacaac taaaaaaaca aaaataataa
aatcaggcaa taaatactag taaaatttgt tatttttact tcgtgtgtag atcgaattta attttacata tttatatagt
gttttatact attattgtaa tctatcttat caaattctat gattttttat aactatttaa actacatgta tgatacacaa
ttagaaaata ctttTCCATA CAAATATATC TTCACATGCA ATGGTGTTTG GAGCTGATCG ACACGTGTCA CTCTGACATG
GCCACACGCA GGTTCCCTAG GTGTCCAGAT CCAGACCGGG TGGTCGGGCT GGCGGCGCAC ACGGACTCAG GCTTCTTCAC
CTTCATCCTG CAGAGCCCCG TGCCGGGGTT GCAGCTGCTC CGCCACCGGC CGGACCGGTG GGTGACGGTT CCGGGGACGC
CGGGGGCGCT CATCGTCGTC GTCGGCGATC TCTTCCATGT GCTCACCAAC GGGCGCTTCC ACAGCGTGTT CCACCGCGCC
GTCGTGAACC GGGAGAGAGA CCGGATCTCC ATGCCCTACT TCCTCGGTCC GCCGGCCGAC ATGAAGGTGA CACCTCTCGT
GGCGGCGGGG TCGCCGGAGA GCAAGGCCGT GTATCAGGCC GTGACATGGC CGGAGTACAT GGCTGTAAGG GATAAGTTGT
TCGGGACAAA TATATCGGCG TTGAGCATGA TTCGAGTAGC GAAGGAAGAG GACAAGGAGA GTTAGAACTA TGGTATGATT
GCAATTATCC ATGCCAGAAA AAAAAAATTA GGGATATGAT TTGTTGTGCT AAAATAAGGA AGGCAAATTT TAATTATAAG
CAAGTATAGG TAGTTTTCCC TTGAATAAAC TTTTTTTCTT AACAGCTTTC ATAAATTGGA AAGGTGAATA CTGACCTGAT
GAGAGTTTCA CTGTAGAACC AGGACAAGGA ATAAGGAATA AGTTGAGGCA ACCTGAACAA TGCT

Locus: Os05g0178100

Loading...

Locus: Os05g0178100

Loading...