Os05t0178600-01

Locus

Os05g0178600

Description

Similar to Auxin-responsive protein (Aux/IAA) (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IAA15

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIAA15

Oryzabase Gene Name Synonym(s)

Aux/IAA protein 15

Transcript Evidence

AK100080 (DDBJ, Best hit)

AK061796 (DDBJ, Best hit)

Protein Evidence

Q6AT10 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

AUX/IAA protein (IPR003311)

Aux/IAA-ARF-dimerisation (IPR011525)

Full-length cDNA

J023001M24 (Online Clone Ordering)

001-039-G05 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0178600-01)

RiceXPro (AK100080)

Others

Oryzabase (10904)

KEGG (Os05t0178600-01)

Transcript

1201 bp

>Os05t0178600-01 Similar to Auxin-responsive protein (Aux/IAA) (Fragment).
TATAATCTCCTCCGCCGCCGCACCTCGCAGAGAGAGAGACGCCGCCGCCGTCGCCGCCGC
CGGCGACCGGAGAGAAAGAGAGAGAAGAGCAACGCCCACGGCTTCGCCGCCGCTGCCGGC
GACCATGTCGGTGGAGACGGAGCGGAGCTCGACGGAGTCATCGGCGGCGTCCGGGCTCGA
CTTCGAGGACACCGCCCTCACCCTCCGCCTCCCGGGctcctcctcctcctcctcctcctc
ctcgtcatcctcctcctcctcgtcgccgtcggagcccgaccgcaagcgcgcctccgccac
cgacgacgaccccgacaaccgcctcggctccaccgccaccgagtcccccccttccccCAA
GGCGCGGGTGGTCGGGTGGCCGCCGGTGCGCGCGTTCCGGAAGAACGCGCTCGCGGCGTT
GGCGGCGGCGTCCTCCAGCAAGGCCAAGTTCGTGAAGGTGGCCGTCGACGGCGCGCCGTA
CCTGCGCAAGGTGGACCTCGAGGCGTACCGGGGCTACGACCAGCTGCTCGCCGCCCTCCA
GGACAAGTTCTTCTCCCACTTCACCATCCGCAAGCTCGGGAACGAGGAGATGAAGCTCGT
CGACGCGGTGAGCGGCAACGAGTACGTGCCGACGTACGAGGACAAGGACGGCGACTGGAT
GCTCGTCGGAGACGTCCCCTGGAAAATGTTTGTGGAGACCTGCCAACGTCTTCGTCTCAT
GAAAAGCTCTGAAGCAGTCAATTTAGCACCAAGATCTGCTTGATGAGTCGCAAATCTCTG
CTCCTGTCTTTGAGAAGCATGAGAGGAAGCCATCTTTGCTTGCTGAGGTTTTTCCATGTC
TGTGAGAGAAATGTGTACAGTCATCGACTTCGACTTTTGGTTCCATCGTGCTATTGAGTT
TCAGAAAAGAAATGGTTTTTAGCTTGTAGCTTTGTTACCAGTCAGTAGTCTCTCCATATA
GATGAGCGAAGCGGTGATGCTTTAAAATACACCCATAGATTGTTTTCTCGATAAATAAAA
TTGGTCTCACTCACTGAGCCCCTGTTCTTCGACATGCTTTCTACCACTAGTTTGTTCGAT
AATGTGATGTGCATGTGAGGCCTGTGATGGTGCAAGAATCATATAACTTGTCATGTTAAT
AACTATTTTGTTGTAAGATTATGTTTACTGCATGGTGTTATAAGCTATTTAAAGTTTACT
C

CDS

639 bp

>Os05t0178600-01 Similar to Auxin-responsive protein (Aux/IAA) (Fragment).
ATGTCGGTGGAGACGGAGCGGAGCTCGACGGAGTCATCGGCGGCGTCCGGGCTCGACTTC
GAGGACACCGCCCTCACCCTCCGCCTCCCGGGctcctcctcctcctcctcctcctcctcg
tcatcctcctcctcctcgtcgccgtcggagcccgaccgcaagcgcgcctccgccaccgac
gacgaccccgacaaccgcctcggctccaccgccaccgagtcccccccttccccCAAGGCG
CGGGTGGTCGGGTGGCCGCCGGTGCGCGCGTTCCGGAAGAACGCGCTCGCGGCGTTGGCG
GCGGCGTCCTCCAGCAAGGCCAAGTTCGTGAAGGTGGCCGTCGACGGCGCGCCGTACCTG
CGCAAGGTGGACCTCGAGGCGTACCGGGGCTACGACCAGCTGCTCGCCGCCCTCCAGGAC
AAGTTCTTCTCCCACTTCACCATCCGCAAGCTCGGGAACGAGGAGATGAAGCTCGTCGAC
GCGGTGAGCGGCAACGAGTACGTGCCGACGTACGAGGACAAGGACGGCGACTGGATGCTC
GTCGGAGACGTCCCCTGGAAAATGTTTGTGGAGACCTGCCAACGTCTTCGTCTCATGAAA
AGCTCTGAAGCAGTCAATTTAGCACCAAGATCTGCTTGA

Protein

213 aa

>Os05t0178600-01 Similar to Auxin-responsive protein (Aux/IAA) (Fragment).
MSVETERSSTESSAASGLDFEDTALTLRLPGSSSSSSSSSSSSSSSSPSEPDRKRASATD
DDPDNRLGSTATESPPSPKARVVGWPPVRAFRKNALAALAAASSSKAKFVKVAVDGAPYL
RKVDLEAYRGYDQLLAALQDKFFSHFTIRKLGNEEMKLVDAVSGNEYVPTYEDKDGDWML
VGDVPWKMFVETCQRLRLMKSSEAVNLAPRSA*

5'UTR

chr05:4684374..4684497 (- strand) : 124 bp

CDS

chr05:4684138..4684373 (- strand) : 236 bp

chr05:4683841..4684049 (- strand) : 209 bp

chr05:4683628..4683742 (- strand) : 115 bp

chr05:4682040..4682101 (- strand) : 62 bp

chr05:4681906..4681922 (- strand) : 17 bp

3'UTR

chr05:4681468..4681905 (- strand) : 438 bp

FASTA

>Os05t0178600-01 class=Sequence position=chr05:4681468..4684497 (- strand)
TATAATCTCC TCCGCCGCCG CACCTCGCAG AGAGAGAGAC GCCGCCGCCG TCGCCGCCGC CGGCGACCGG AGAGAAAGAG
AGAGAAGAGC AACGCCCACG GCTTCGCCGC CGCTGCCGGC GACCATGTCG GTGGAGACGG AGCGGAGCTC GACGGAGTCA
TCGGCGGCGT CCGGGCTCGA CTTCGAGGAC ACCGCCCTCA CCCTCCGCCT CCCGGGctcc tcctcctcct cctcctcctc
ctcgtcatcc tcctcctcct cgtcgccgtc ggagcccgac cgcaagcgcg cctccgccac cgacgacgac cccgacaacc
gcctcggctc caccgccacc gagtcccccc cttccccCAA GTACGCGCTC TCTCTCTCTC TCTCTCTCTG ACTTGATTTT
GGCCCATTTG AGGTTGCAGC CTGACATGGC GCGTCGCGGC GGGCGCAGGG CGCGGGTGGT CGGGTGGCCG CCGGTGCGCG
CGTTCCGGAA GAACGCGCTC GCGGCGTTGG CGGCGGCGTC CTCCAGCAAG GCCAAGTTCG TGAAGGTGGC CGTCGACGGC
GCGCCGTACC TGCGCAAGGT GGACCTCGAG GCGTACCGGG GCTACGACCA GCTGCTCGCC GCCCTCCAGG ACAAGTTCTT
CTCCCACTTC ACCATCCGTG AGTCGACATG CTCGTGCGCC TCTGTGCCTT TCCGCTGTTC TTGCGCGATG CCGTACGTTG
TTGAGAGCTC TGGATGCGTT CGTCCATGGC CGCAGGCAAG CTCGGGAACG AGGAGATGAA GCTCGTCGAC GCGGTGAGCG
GCAACGAGTA CGTGCCGACG TACGAGGACA AGGACGGCGA CTGGATGCTC GTCGGAGACG TCCCCTGGAA GTGAGTTAGT
TAATTTTGGT TTGATTCCCT ACTAGTAGCT TCTCTGTTAT GCTTGGAATT GGATTAAATT TTAATCTGCA GATGCAGAAG
CTAGCGTATG ATGTTTATGT TCATCTAGAC AGTGGTCGAT GGATCAGTTA TCGGTTTCTC TGTTCGATTG GGTGCAGTAG
TATGTCAGTT TCTCTGTTCG ATTGGGTGTA GTAGTTAATT TCAGTTCCAG TACAACTCAT GATGGATCTG GTACCAGCAA
CATAGGAAAT TGGGATTTTC ATGCTTACTG TGTTAGTATG TTATGATTCA AGGCTAACGT TTTCCTATAT GGAACATGAG
TCATGGGGGT AGTTCTTTTT TTTTTTCAAT TCTGACATAA AAATTTTGAT TTTCTGGTTG GGTACCATTT GTTATTTGTG
GGATATTGCG CAAATGGCCC TTTACTTATG GGTTGTGGAT CATGTTAGGT TCTTTAAGTA GGAGTTTAGC AGCAAGCTAA
CGTAATAAAT TTAGCTAAGA AATTATTTGC TGCAAATGAT GATGAGATAT TCCATTTGAT GGGAGACGGA GTGTATGCAG
CGGCTACATC CATGAACCTA GGATCCAAAT AGAACAACTG GAACGAAGTG CTTGAAGGCA TTTACCCCTT TTTACTCCTA
TGATGCATTA GGCAGAGCTC CTAAACTCAT ATACATATAC TAGTTTCTTT TTTCTGACAA TAACCTGCTT TCTTTGTGTT
GTATAACTTA TAAATGCACC AAATGTACAA GCCACGGTGT GATTGTGAAA ATGGAACTAC TTACTCTCCT TTCATGTGAA
ACTGAGAAAC TCTGAAGGGT GAAAATATTG AATTGAAATG TGGAATTATA CTGACCTCAA AGTTTTGTCT TATCTCATTC
CATCCAGATA TTCTAAGTTT TTAGAAATCA ATAGTATCCC TGGGAGTTGT CACTTTGGTT CATTTTGCTG TATCTTTGCA
TTAATCATTA GTAGGTTGAA CAAACCTTTT CTTTTCTTGA GAACCGACAA GGTAAACAAC CCCCTTTTTT TTGAGAGAAC
AAGCTAAACA ACTTTGATGT ATTTGTTTCT CCACATAGAT AAATAATGGC CTGAACATTA AAGAATTGAT TTGGTTATGA
TAGCGTGCTT TTGATAAGGT TGTATTTCCA GCTTGCTTGT TCTTGTCTAC CTTTTGGTTT AACACTGATC AACAAACATT
TCTTTTTCAT TGTGGTCAAC TGTATCATTT TAGTTTTATG TTTCTCCTTT TGCTTTGCAT AACATCTTTT CACTAAAGTT
AAATTCCTGT CACACTATTA TTTACATAGA CCTATAGGAG ATCTGATTCC TATCTAGGGA CACATCTGAA TTCTTAGCCA
TGATGGGATG TTACTTTTCC TTTTTCTTTT ATTTGTCAGA TCACAGCCAA CTGAGTTACT GTGCTTTACA TGAAAACTGA
AATGGTTTAG AGGGATGATA TTTTCTCCAA AAAGTTTAGT CTATAAAAAG TTCTAATGTG CTATTTTTTC CTGCAGAATG
TTTGTGGAGA CCTGCCAACG TCTTCGTCTC ATGAAAAGCT CTGAAGCAGT CAATTTAGGT ACAGTGTCCT CTTGGTCTTG
TATGTTGTTT TTCATAGTTG CCACCGTGAC TTTCTGTATG GTTCAACAAC GTATTTTCGG GCAAAATCCT AAATTTTCCC
CCTTCTCACA TGCAGCACCA AGATCTGCTT GATGAGTCGC AAATCTCTGC TCCTGTCTTT GAGAAGCATG AGAGGAAGCC
ATCTTTGCTT GCTGAGGTTT TTCCATGTCT GTGAGAGAAA TGTGTACAGT CATCGACTTC GACTTTTGGT TCCATCGTGC
TATTGAGTTT CAGAAAAGAA ATGGTTTTTA GCTTGTAGCT TTGTTACCAG TCAGTAGTCT CTCCATATAG ATGAGCGAAG
CGGTGATGCT TTAAAATACA CCCATAGATT GTTTTCTCGA TAAATAAAAT TGGTCTCACT CACTGAGCCC CTGTTCTTCG
ACATGCTTTC TACCACTAGT TTGTTCGATA ATGTGATGTG CATGTGAGGC CTGTGATGGT GCAAGAATCA TATAACTTGT
CATGTTAATA ACTATTTTGT TGTAAGATTA TGTTTACTGC ATGGTGTTAT AAGCTATTTA AAGTTTACTC 

Locus: Os05g0178600

Loading...

Locus: Os05g0178600

Loading...