Os05t0179000-01

Locus

Os05g0179000

Description

Zinc finger, RING/FYVE/PHD-type domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsRFPH2-5, DLN133, OsDLN133

Oryzabase Gene Name Synonym(s)

RING finger protein OsRFPH2-5, RING-H2 protein 5, DLN repressor 133, DLN motif protein 133

Transcript Evidence

AK071804 (DDBJ, Best hit)

Protein Evidence

B6TV66 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

Zinc finger, RING-type (IPR001841)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Zinc finger, C3HC4 RING-type (IPR018957)

Full-length cDNA

J023110J02 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0179000-01)

RiceXPro (AK071804)

Others

Oryzabase (11766)

KEGG (Os05t0179000-01)

Transcript

1866 bp

>Os05t0179000-01 Zinc finger, RING/FYVE/PHD-type domain containing protein.
GAGTCAAGTCGCCGACTTTTGGAGTTCTCCTCGCCCCAGCTCGGTAAATTCCTTCGCTTT
TTCTCCGCTGGTTCGGAGATTTCCATGTTCACTTTTGTTTTTTTTTTTAATTAAGGGCTT
TGCTTTGATGGAAGGGTTGGGTACTGGTTCCTTCCCTCCGGATCAATCTTGCTTCTTGCG
CTCACCCAACCTAGTAATTTTTTCCTCTCCCGATTTGTTTAATGCTAATCTAGGTGGTTG
ATGATGCTTGCGAGCCAGGCATTGATTCGGCTTTAAGCTTGCCTGCTTGCTTCGCCGTCT
TGTTCTTTGAGTTCTTGGTTTTCATGGATCCTTGATCCGATTTAGGGGTTGCTGCTGCTA
GCCGTGGTTGGTGAGACGGTTCTTGGAGAAGGGGGATTTCTTGAGGTGCTTTTCTGGGAG
GTGTAACCAACTAAATTCCTATGCTACCTTCTGGTTGATGGCCGTCCCTCCTGTTGAATC
AGAAACAAGAAGTGAAGAAACAGATAATTTCCCTTTACTTGCAGACCACATGGAAAATAC
TGGACATCATGCACATGCAGTTGATATCCCATGGGATTCTTCACCATCGACATCTCGCCG
AGATAATCATAATGGATTTGATCAATTACCTCGTATCTTAGAAGGTTCTCCTGGGACATC
TACTCCATCTAACTCTCAGAATGGTCCTCTAGCAAGAAGAGATGATAATCGTGGTCGTCG
TCAGCCTAGTCCCTTGAATTCTGGTTGCTGGATCTCAGTTGAGCTAGTTGTAAATGTTAG
CCAGATCATAGCAGCTATTTGTGTTCTGTCAGTATCAAGGAATGAGCATCCACACTCTCC
GTTATTTGAGTGGGTCATTGGTTATACAGTAGGTTGTACTGCCACGCTGCCTCATCTTTA
CTGGCGCTATCTCCATCGCAACCTCCCAACCACTGGGCAAGAGCCAACAGTTCAGAATAT
CCCTCCAAACAACACCCCTGAAGCTAATTCATATGGAGTAACCGGCACAAATGGAGTCTC
AAGAAACAATGAGGCAACAGTAAATCCAAGGTTCCAAGCTTTTGCTGATCACTTCAAAAT
GGCTCTGGACTGTTTCTTTGCTGTGTGGTTCGTTGTGGGAAATGTATGGGTATTTGGTGG
ACATTCTTCTGCTCACGACGCGCCCAACTTGTACAGGTTGTGTATTGCCTTCCTCACATT
CAGCTGCATCGGCTATGCTATGCCTTTCATCCTCTGCGCATTGATATGTTGCTGCCTACC
CTGCATAATCTCTATCTTGGGATTTCGGGAAGATCTAAACCAAAACAGAGGAGCTAGTGC
GGAAACAATCAATGCCTTGGGAACATGCAAGTTCAAGTCAAAGAAAACTCGTGATGGAGA
TGGAAACGAAGTTGGTGTCGGTGTTGTGGCTGCTGGAACAAACAAGGAGCGAGTCATTTC
TGCAGAAGATGCTGTCTGCTGCATCTGCTTGGCCAGATATGTCGATAACGATGATCTCCG
AGAGCTCCCTTGTGCGCACTTCTTCCACAAGGATTGTGTGGACAAATGGCTCAAGATAAA
CGCGCTGTGCCCCCTTTGCAAGGCTGAGATAGATGGTGTCTCCACAAGTGCTCCAGCCAT
TGGCTTTGGGCGTCGCCACAGCGACAACAGGGTAGGAAACGACATTGAATCACAACTATA
ACTCTCTTCCCACTTCGTTGGCAGCGTGGATCACGCCTTTGATGAGGCCTTCCACACATC
AACCTGTAAATTATAGAGGTAGACATCAAGATGTAAAGGGTCCTCTTACGATCCAACAAA
GTTCTTTTCTGAATGACTACTGCCTCCACTGTCAGTATATATTGCTTCCAGCATTTGTTT
CTTCTC

CDS

1224 bp

>Os05t0179000-01 Zinc finger, RING/FYVE/PHD-type domain containing protein.
ATGGCCGTCCCTCCTGTTGAATCAGAAACAAGAAGTGAAGAAACAGATAATTTCCCTTTA
CTTGCAGACCACATGGAAAATACTGGACATCATGCACATGCAGTTGATATCCCATGGGAT
TCTTCACCATCGACATCTCGCCGAGATAATCATAATGGATTTGATCAATTACCTCGTATC
TTAGAAGGTTCTCCTGGGACATCTACTCCATCTAACTCTCAGAATGGTCCTCTAGCAAGA
AGAGATGATAATCGTGGTCGTCGTCAGCCTAGTCCCTTGAATTCTGGTTGCTGGATCTCA
GTTGAGCTAGTTGTAAATGTTAGCCAGATCATAGCAGCTATTTGTGTTCTGTCAGTATCA
AGGAATGAGCATCCACACTCTCCGTTATTTGAGTGGGTCATTGGTTATACAGTAGGTTGT
ACTGCCACGCTGCCTCATCTTTACTGGCGCTATCTCCATCGCAACCTCCCAACCACTGGG
CAAGAGCCAACAGTTCAGAATATCCCTCCAAACAACACCCCTGAAGCTAATTCATATGGA
GTAACCGGCACAAATGGAGTCTCAAGAAACAATGAGGCAACAGTAAATCCAAGGTTCCAA
GCTTTTGCTGATCACTTCAAAATGGCTCTGGACTGTTTCTTTGCTGTGTGGTTCGTTGTG
GGAAATGTATGGGTATTTGGTGGACATTCTTCTGCTCACGACGCGCCCAACTTGTACAGG
TTGTGTATTGCCTTCCTCACATTCAGCTGCATCGGCTATGCTATGCCTTTCATCCTCTGC
GCATTGATATGTTGCTGCCTACCCTGCATAATCTCTATCTTGGGATTTCGGGAAGATCTA
AACCAAAACAGAGGAGCTAGTGCGGAAACAATCAATGCCTTGGGAACATGCAAGTTCAAG
TCAAAGAAAACTCGTGATGGAGATGGAAACGAAGTTGGTGTCGGTGTTGTGGCTGCTGGA
ACAAACAAGGAGCGAGTCATTTCTGCAGAAGATGCTGTCTGCTGCATCTGCTTGGCCAGA
TATGTCGATAACGATGATCTCCGAGAGCTCCCTTGTGCGCACTTCTTCCACAAGGATTGT
GTGGACAAATGGCTCAAGATAAACGCGCTGTGCCCCCTTTGCAAGGCTGAGATAGATGGT
GTCTCCACAAGTGCTCCAGCCATTGGCTTTGGGCGTCGCCACAGCGACAACAGGGTAGGA
AACGACATTGAATCACAACTATAA

Protein

408 aa

>Os05t0179000-01 Zinc finger, RING/FYVE/PHD-type domain containing protein.
MAVPPVESETRSEETDNFPLLADHMENTGHHAHAVDIPWDSSPSTSRRDNHNGFDQLPRI
LEGSPGTSTPSNSQNGPLARRDDNRGRRQPSPLNSGCWISVELVVNVSQIIAAICVLSVS
RNEHPHSPLFEWVIGYTVGCTATLPHLYWRYLHRNLPTTGQEPTVQNIPPNNTPEANSYG
VTGTNGVSRNNEATVNPRFQAFADHFKMALDCFFAVWFVVGNVWVFGGHSSAHDAPNLYR
LCIAFLTFSCIGYAMPFILCALICCCLPCIISILGFREDLNQNRGASAETINALGTCKFK
SKKTRDGDGNEVGVGVVAAGTNKERVISAEDAVCCICLARYVDNDDLRELPCAHFFHKDC
VDKWLKINALCPLCKAEIDGVSTSAPAIGFGRRHSDNRVGNDIESQL*

5'UTR

chr05:4710637..4711041 (+ strand) : 405 bp

chr05:4713386..4713437 (+ strand) : 52 bp

CDS

chr05:4713438..4714030 (+ strand) : 593 bp

chr05:4714380..4714505 (+ strand) : 126 bp

chr05:4714594..4714870 (+ strand) : 277 bp

chr05:4714973..4715200 (+ strand) : 228 bp

3'UTR

chr05:4715201..4715385 (+ strand) : 185 bp

FASTA

>Os05t0179000-01 class=Sequence position=chr05:4710637..4715385 (+ strand)
GAGTCAAGTC GCCGACTTTT GGAGTTCTCC TCGCCCCAGC TCGGTAAATT CCTTCGCTTT TTCTCCGCTG GTTCGGAGAT
TTCCATGTTC ACTTTTGTTT TTTTTTTTAA TTAAGGGCTT TGCTTTGATG GAAGGGTTGG GTACTGGTTC CTTCCCTCCG
GATCAATCTT GCTTCTTGCG CTCACCCAAC CTAGTAATTT TTTCCTCTCC CGATTTGTTT AATGCTAATC TAGGTGGTTG
ATGATGCTTG CGAGCCAGGC ATTGATTCGG CTTTAAGCTT GCCTGCTTGC TTCGCCGTCT TGTTCTTTGA GTTCTTGGTT
TTCATGGATC CTTGATCCGA TTTAGGGGTT GCTGCTGCTA GCCGTGGTTG GTGAGACGGT TCTTGGAGAA GGGGGATTTC
TTGAGGTAGG TGGTAGCGGT AGATTTCCTT TCTGTTCTAT GCCCTCTTCA ATTGAATTTT TGGAAGTCTC CAGCGTTTTA
TTTTTGGAAG TTTTGTAGTT TGTGAAACTA ATTGATGAAT GAATGTGAGG GGAAATTGGT AGATTTCGTG TTGTGCTGCT
ACTAGACCAT TTCCTGACCC ATGTGGCATG GGAGCCATTT GATTGTTATT CTCATTGTGG AGGTTATGAG TTGATATTTC
CAGATTTTGT GCATGAATGT TCAAAATGTT TAGTTCTGTT TCGTTAGGAC TTCAAATAGG TAGAATTAGT TAGTGTCTTG
GGGCTGCATG GAAGAAGATT GGAAGAATTT AATTTGTTAC ATTAGAACTT CAAATAGGCA TTGTTGTTGT AGGCTCAAAC
TTTTACATTG TACTGTTATC TTCATCTACT CTGACTGATG TCCAAAGAAT GCACATGCCC AGCTCGTCCC TGTCTCTTGA
TGCTTTCGGT TTGTTCATAG TTTATATAAA TTCTTGGGTC TCATTAGCTA TGTACTATAA TTTAATAGCT AGTGACCACC
CTGATGTTTC TGTAGCATGC TATCAGTGGG TATATCGACC TGTTTATGTT GCAATTGATG ACCATTTCAC ATCTTGTTCT
GTCATGTGCA TTCCACGATG TTTCTTTCAT TGTGATGAAG ATGAATACAG TAACAAGATG CAAATCAAAA CATTGTTTTC
TGTGTGAATC ATATATCCTC TCTATAGTGG TTTACAAACA CCCCTGGGTC ATTAGGAAAG CACCCAAAGT TTTACTTGCT
ATTGAATATG GTTTAAACAT AGCTTTTTCA TACCAGTTTC AGGCATAAGT GTATATTATG TATGTTCGGT AAAAATAAGT
GTATATATTT ATTCCGTATG TGCTAATCTT AGGAGCTTGT GATCCCAGAG AATTTATTCT AATATTCGAT AAGTAGTATA
TGCATATGGT taggggtgaa aacggtaacg gtaattaccg gccgaccggc gttcattttc gactttctac cggccgagcc
atatggaaat ggtaatcgac cgaaacaaaa atggaaatgg taaaaaatat ggaaatgaaa acggaaatgg ttttgctgtt
ataccgatcg tttccgtatt tactgtattc ttgcggaaat taccgtttct tataatatgg taattaccgt attctaaata
tgtcgatatt ataggacatg tttatacttg acccacagct tatagattga atgactcttc aataaaatct ctaacttttg
tacatggcta aaatgaagtt aatttataat ttatatagta taagcttgaa tttatgtata tatataacat acttatgtaa
agttaaatat atgtttttat agtttaatgt ttccgtattt gttaccgatt tccgatctgt accgacatgt ttccgtccgt
attgttccgt ttccggtttt ccgatatttc cgatatcgtt ttcgtttccg actttaccgt ttccgatttc gtttccgaga
aaaatatggt tacggaaatg gttgaggctg ttttccgatc gtttccgacc gttttcatcc ctaCATATGG TATAGAATTT
ATTTGAGAAT CTTCTCCATA TTTTTGGGTG GTGCACATGT ATTGTACGGT TGAGTCTAAC AATGATGTTA TGGCACACAT
TTATACACAG ACTTGCTTGT CCTCACAAAT CAAGCCATTA GTATGAATCA CCAGGTCAGA GCTCAGAGCA TAAATTTCTA
AGCCTAAGAG CACCTGTCAG ATAAGCAGGA TTTAGTCTTT TACGCTAGCT CAATCGTATC TTAGTGACAA TTTAGGTCTG
GTTTGGATTG GCATCAATCT GCGGCCTACT AATATTCTGG TTGCTTTGAT GGTACCTTGT TGATATTTGG ATTGAAGCCA
ATTTTTGCCT ACAATACGAA AATTTGACTA ATAGCTAGTA acaaatctac tctaccaaat ttgctagtgc caaaacttgc
ctaggtttcg gcactaccaa cattttggta gggctttaaa ccaaacCGAC CCTTAAAGTC ATGTCAAGAT GCTGAAACAA
ACAAACCATC CCTTTTTCCT AATGCTTTTG ATAGGCTTCT GTATACCACA TTGACCAAAA GGCAATCAAC AAAATCACGT
TTGGCTTATT ATGTTTGCCA TGTCTTACTA CAGAAGATAA CAGGCTTGGT TTAAGGGGGC TAGATAAATA TGTAATTGAT
CTCCAGTGTT TTTTTTGTTC AAGTTGAGTG AAGATGACCT GATCCTGTTG GGAAAATAAA TTGGATTAAG TGGATTTGAT
AGAGTGATAT TAATTTTAAT TTGATGCAGG TGCTTTTCTG GGAGGTGTAA CCAACTAAAT TCCTATGCTA CCTTCTGGTT
GATGGCCGTC CCTCCTGTTG AATCAGAAAC AAGAAGTGAA GAAACAGATA ATTTCCCTTT ACTTGCAGAC CACATGGAAA
ATACTGGACA TCATGCACAT GCAGTTGATA TCCCATGGGA TTCTTCACCA TCGACATCTC GCCGAGATAA TCATAATGGA
TTTGATCAAT TACCTCGTAT CTTAGAAGGT TCTCCTGGGA CATCTACTCC ATCTAACTCT CAGAATGGTC CTCTAGCAAG
AAGAGATGAT AATCGTGGTC GTCGTCAGCC TAGTCCCTTG AATTCTGGTT GCTGGATCTC AGTTGAGCTA GTTGTAAATG
TTAGCCAGAT CATAGCAGCT ATTTGTGTTC TGTCAGTATC AAGGAATGAG CATCCACACT CTCCGTTATT TGAGTGGGTC
ATTGGTTATA CAGTAGGTTG TACTGCCACG CTGCCTCATC TTTACTGGCG CTATCTCCAT CGCAACCTCC CAACCACTGG
GCAAGAGCCA ACAGTTCAGA ATATCCCTCC AAACAACACC CCTGAAGCTA ATTCATATGG AGTAACCGGC ACAAATGGAG
TCTCAAGAAA CAATGAGGCA ACAGTAAATC CAAGGTAACC GATTCTTCCA ACTGAAGTCT TTTTTTTGTT TTTGAAATTG
ATTTGTCTGC ATATATCTAG TATCTAGACT CTATGGTACA AGGCATGTTA ACCAACTGCA CTAGTAATTA TCACAATTTA
AGATATTAGG CCTACACAGG AATAACTAAA TTCTGTTGGT TGATCACAAC TAAATTCGTA TAGAAATATT TGATCACTGC
ACTCCTATCA GAAGTTCTGT TATTCAGGTT ATATTTCATA TGCAATAAAC TACGTATGGT CTTCCAGAGA TTTAAGTTTC
CCATGTTTTA TTAACTTTTC CTTTAGTCCA AGTTCTGAGC TACAGTCTTA CCATTTGTTT TAGGTTCCAA GCTTTTGCTG
ATCACTTCAA AATGGCTCTG GACTGTTTCT TTGCTGTGTG GTTCGTTGTG GGAAATGTAT GGGTATTTGG TGGACATTCT
TCTGCTCACG ACGCGCCCAA CTTGTACAGG TATGATGCTT GCCTACATTG TGTTGTAGAT CTGTGACTTA ACCAAAAATT
TATTTGGATG TTTCATCATG CAATATTTCT TCCCCAGGTT GTGTATTGCC TTCCTCACAT TCAGCTGCAT CGGCTATGCT
ATGCCTTTCA TCCTCTGCGC ATTGATATGT TGCTGCCTAC CCTGCATAAT CTCTATCTTG GGATTTCGGG AAGATCTAAA
CCAAAACAGA GGAGCTAGTG CGGAAACAAT CAATGCCTTG GGAACATGCA AGTTCAAGTC AAAGAAAACT CGTGATGGAG
ATGGAAACGA AGTTGGTGTC GGTGTTGTGG CTGCTGGAAC AAACAAGGAG CGAGTCATTT CTGCAGAAGA TGCTGTGAGT
TTTTCTCCCA GACTCTTTTA TACTTCACAA CTAAAATCTA GTTATCTCCT CTTGGTGCTC TTAGTTTAAA ATTAAGGGGT
GCTCTTGGAA TTGCAGGTCT GCTGCATCTG CTTGGCCAGA TATGTCGATA ACGATGATCT CCGAGAGCTC CCTTGTGCGC
ACTTCTTCCA CAAGGATTGT GTGGACAAAT GGCTCAAGAT AAACGCGCTG TGCCCCCTTT GCAAGGCTGA GATAGATGGT
GTCTCCACAA GTGCTCCAGC CATTGGCTTT GGGCGTCGCC ACAGCGACAA CAGGGTAGGA AACGACATTG AATCACAACT
ATAACTCTCT TCCCACTTCG TTGGCAGCGT GGATCACGCC TTTGATGAGG CCTTCCACAC ATCAACCTGT AAATTATAGA
GGTAGACATC AAGATGTAAA GGGTCCTCTT ACGATCCAAC AAAGTTCTTT TCTGAATGAC TACTGCCTCC ACTGTCAGTA
TATATTGCTT CCAGCATTTG TTTCTTCTC

Locus: Os05g0179000

Loading...

Locus: Os05g0179000

Loading...