Os05t0179300-01

Locus

Os05g0179300

Description

Transferase family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

AT7

CGSNL Gene Name

ACYLTRANSFERASE 7

Oryzabase Gene Symbol Synonym(s)

OsAT7, OsAt7

Oryzabase Gene Name Synonym(s)

acyltransferase 7

Transcript Evidence

AK100028 (DDBJ, Best hit)

Protein Evidence

B6TZV1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups (GO:0016747)

Functional domain (InterPro)

Transferase (IPR003480)

Chloramphenicol acetyltransferase-like domain (IPR023213)

Full-length cDNA

J013147B02 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0179300-01)

RiceXPro (AK100028)

Others

Oryzabase (11739)

KEGG (Os05t0179300-01)

Transcript

1895 bp

>Os05t0179300-01 Transferase family protein.
ATTCAATTCACTCCCCCCTCCAGCTTCTCACTCCCCACACGCAGCTTCCAGCTCATCACC
CCCCACAACCACCTCCTCCCCCTCCCATGGCGGCGGCGGCGCCGGACAAGGCGGTGGAGC
GGCTGTCCCAGAAGCTGGTGCACCCGTCGTCCCCCACGCCGTCGGCCCCGCTCCGCCTCT
CCTGGCTCGACCGCTACCCCACCCAGATGGCGCTCATCGAGTCGCTCcacgtcttcaagc
ccgacccggcgagggacgccgcggggcaggggctcgcccccgcgcgcgccatcgagacgg
ccctcgcgagagccctcgtcgagTACTACCCGCTCGCCGGGAGGCTCGCCGTCTCCCGGG
ACTCCGGCGAGCTCCAGGTGGATTGCTGCGGCGGCGCCGGCGGCCATGGCGGGGTGTGGT
TCATCGAGGCGGCTGTCCCGTGCCGGCTCGAGGACGTGGATTACCTCGAGTACCCTCTCG
CCATCTCCAAGGACGAGCTGCTCCCCCACCCGCGCCCCCGCCCCACCCGCGACGAGGAAG
ACAAGCTCATCCTGCTCGTCCAGGTGACGACGTTCGCGTGCGGCGGGTTCGTGGTGGGGT
TCAGGTTCAGCCACGCGGTGGCGGACGGCCCGGGGGCGGCGCAGTTCATGGGCGCGGTCG
GCGAGCTCGCCCGCGGCGGCGAGCGCATCACGGTGGCCCCGTCGTGGGGGCGCGACGCGG
TGCCCGACCCGGCCGGCGCCATGGTCGGCGCCCTCCCGGAGCCGGCCGGCGCGTCCCGCC
TCGAGTACCTCGCCATCGACATCTCCGCCGACTACATCAACCACTTCAAGTCCCAGTTCG
CGGCGGCCACCGGCGGCGCCCGCTGCTCCGCCTTCGAGGTGCTCATCGCCAAGGCATGGC
AGAGCCGCACCCGCGCCGCCGCGTTCGACCCCTCGACGCCGATCAACCTCTCCTTCGCCA
TGAACGCCCGGCCGCTCCTCCTCCCGCGCGGCGGCGCCGGGTTCTACGGCAACTGCTACT
ACATCATGCGGGTGGCCTCCACCGCCGGGAGGGTGGCGACGGCGAGCGTCACCGACGTGG
TGAGGATGATCCGGGAGGGGAAGAAGCGGCTCCCGTCGGAGTTCGCGCGGTGGGCCGCCG
GAGAGATGGCCGGAGTCGACCCGTACCAGATCACCTCCGACTACCGGACGCTGCTGGTCT
CCGACTGGACGCGGCTGGGCTTCGCCGAGGTGGACTACGGGTGGGGCCCACCGGGCCACG
TCGTGCCGCTCACGAACCTGGACTACATCGCCACGTGTATCCTCGTCAAGCCCTGGGCCC
ACAAACCAGGGGCACGGCTCATCACCCAGTGCGTCACACCCGACCGCGTCACCGCCTTCC
ACGACGCCATGGTGGACATCAACTAATTTATTATTATAATTATAATTATTATTATTATTA
TTATTCCCTTTTCTTTTTATTTTATTTTTTTTACCACGCCACCTTTTTCACTTTGTTTTT
TTACCACTACTTCCTTATAATTAATTAATTAATTAATTAGATATTAATAATGAAGAATTA
AGGGTAAAAAAAGGAGAGGATAAAGAAAGGTGAAAAGTACATATTGATATTGAGGGTACA
GGTAGATGGTAGTAGTTGTTGGCATTATTAGTGGGATTGGTATTGGATTCCTTTGGTGTT
GTTTGGTCAAGTGTATACTGGAGAACAGCTACTACATGCTGGGTATTCCTTTTATTTTTT
TTTCTTTTTTTTGGGATCAAAAGCTGGAATTGGTGGGAAGCCACCAACTAACCAGTATGT
CCCCCTTGATAAGTGTACCATATATTGTATTCAATTTTTATCTTATTTTCAGAATGGTAT
ATATAAGCTGGCAAGGTGTACAGCCTCTTTAGTTG

CDS

1320 bp

>Os05t0179300-01 Transferase family protein.
ATGGCGGCGGCGGCGCCGGACAAGGCGGTGGAGCGGCTGTCCCAGAAGCTGGTGCACCCG
TCGTCCCCCACGCCGTCGGCCCCGCTCCGCCTCTCCTGGCTCGACCGCTACCCCACCCAG
ATGGCGCTCATCGAGTCGCTCcacgtcttcaagcccgacccggcgagggacgccgcgggg
caggggctcgcccccgcgcgcgccatcgagacggccctcgcgagagccctcgtcgagTAC
TACCCGCTCGCCGGGAGGCTCGCCGTCTCCCGGGACTCCGGCGAGCTCCAGGTGGATTGC
TGCGGCGGCGCCGGCGGCCATGGCGGGGTGTGGTTCATCGAGGCGGCTGTCCCGTGCCGG
CTCGAGGACGTGGATTACCTCGAGTACCCTCTCGCCATCTCCAAGGACGAGCTGCTCCCC
CACCCGCGCCCCCGCCCCACCCGCGACGAGGAAGACAAGCTCATCCTGCTCGTCCAGGTG
ACGACGTTCGCGTGCGGCGGGTTCGTGGTGGGGTTCAGGTTCAGCCACGCGGTGGCGGAC
GGCCCGGGGGCGGCGCAGTTCATGGGCGCGGTCGGCGAGCTCGCCCGCGGCGGCGAGCGC
ATCACGGTGGCCCCGTCGTGGGGGCGCGACGCGGTGCCCGACCCGGCCGGCGCCATGGTC
GGCGCCCTCCCGGAGCCGGCCGGCGCGTCCCGCCTCGAGTACCTCGCCATCGACATCTCC
GCCGACTACATCAACCACTTCAAGTCCCAGTTCGCGGCGGCCACCGGCGGCGCCCGCTGC
TCCGCCTTCGAGGTGCTCATCGCCAAGGCATGGCAGAGCCGCACCCGCGCCGCCGCGTTC
GACCCCTCGACGCCGATCAACCTCTCCTTCGCCATGAACGCCCGGCCGCTCCTCCTCCCG
CGCGGCGGCGCCGGGTTCTACGGCAACTGCTACTACATCATGCGGGTGGCCTCCACCGCC
GGGAGGGTGGCGACGGCGAGCGTCACCGACGTGGTGAGGATGATCCGGGAGGGGAAGAAG
CGGCTCCCGTCGGAGTTCGCGCGGTGGGCCGCCGGAGAGATGGCCGGAGTCGACCCGTAC
CAGATCACCTCCGACTACCGGACGCTGCTGGTCTCCGACTGGACGCGGCTGGGCTTCGCC
GAGGTGGACTACGGGTGGGGCCCACCGGGCCACGTCGTGCCGCTCACGAACCTGGACTAC
ATCGCCACGTGTATCCTCGTCAAGCCCTGGGCCCACAAACCAGGGGCACGGCTCATCACC
CAGTGCGTCACACCCGACCGCGTCACCGCCTTCCACGACGCCATGGTGGACATCAACTAA

Protein

440 aa

>Os05t0179300-01 Transferase family protein.
MAAAAPDKAVERLSQKLVHPSSPTPSAPLRLSWLDRYPTQMALIESLHVFKPDPARDAAG
QGLAPARAIETALARALVEYYPLAGRLAVSRDSGELQVDCCGGAGGHGGVWFIEAAVPCR
LEDVDYLEYPLAISKDELLPHPRPRPTRDEEDKLILLVQVTTFACGGFVVGFRFSHAVAD
GPGAAQFMGAVGELARGGERITVAPSWGRDAVPDPAGAMVGALPEPAGASRLEYLAIDIS
ADYINHFKSQFAAATGGARCSAFEVLIAKAWQSRTRAAAFDPSTPINLSFAMNARPLLLP
RGGAGFYGNCYYIMRVASTAGRVATASVTDVVRMIREGKKRLPSEFARWAAGEMAGVDPY
QITSDYRTLLVSDWTRLGFAEVDYGWGPPGHVVPLTNLDYIATCILVKPWAHKPGARLIT
QCVTPDRVTAFHDAMVDIN*

5'UTR

chr05:4736961..4737046 (- strand) : 86 bp

CDS

chr05:4736484..4736960 (- strand) : 477 bp

chr05:4735549..4736391 (- strand) : 843 bp

3'UTR

chr05:4735060..4735548 (- strand) : 489 bp

FASTA

>Os05t0179300-01 class=Sequence position=chr05:4735060..4737046 (- strand)
ATTCAATTCA CTCCCCCCTC CAGCTTCTCA CTCCCCACAC GCAGCTTCCA GCTCATCACC CCCCACAACC ACCTCCTCCC
CCTCCCATGG CGGCGGCGGC GCCGGACAAG GCGGTGGAGC GGCTGTCCCA GAAGCTGGTG CACCCGTCGT CCCCCACGCC
GTCGGCCCCG CTCCGCCTCT CCTGGCTCGA CCGCTACCCC ACCCAGATGG CGCTCATCGA GTCGCTCcac gtcttcaagc
ccgacccggc gagggacgcc gcggggcagg ggctcgcccc cgcgcgcgcc atcgagacgg ccctcgcgag agccctcgtc
gagTACTACC CGCTCGCCGG GAGGCTCGCC GTCTCCCGGG ACTCCGGCGA GCTCCAGGTG GATTGCTGCG GCGGCGCCGG
CGGCCATGGC GGGGTGTGGT TCATCGAGGC GGCTGTCCCG TGCCGGCTCG AGGACGTGGA TTACCTCGAG TACCCTCTCG
CCATCTCCAA GGACGAGCTG CTCCCCCACC CGCGCCCCCG CCCCACCCGC GACGAGGAAG ACAAGCTCAT CCTGCTCGTC
CAGGTACGCC TCCGCCTCCG CCGCCGCCGC CGCATTTGGG ATCGATTCAG GTGTTTGTGC TGCCATGAGC TCACCGGCGG
CGAGTGGTAA TGCAGGTGAC GACGTTCGCG TGCGGCGGGT TCGTGGTGGG GTTCAGGTTC AGCCACGCGG TGGCGGACGG
CCCGGGGGCG GCGCAGTTCA TGGGCGCGGT CGGCGAGCTC GCCCGCGGCG GCGAGCGCAT CACGGTGGCC CCGTCGTGGG
GGCGCGACGC GGTGCCCGAC CCGGCCGGCG CCATGGTCGG CGCCCTCCCG GAGCCGGCCG GCGCGTCCCG CCTCGAGTAC
CTCGCCATCG ACATCTCCGC CGACTACATC AACCACTTCA AGTCCCAGTT CGCGGCGGCC ACCGGCGGCG CCCGCTGCTC
CGCCTTCGAG GTGCTCATCG CCAAGGCATG GCAGAGCCGC ACCCGCGCCG CCGCGTTCGA CCCCTCGACG CCGATCAACC
TCTCCTTCGC CATGAACGCC CGGCCGCTCC TCCTCCCGCG CGGCGGCGCC GGGTTCTACG GCAACTGCTA CTACATCATG
CGGGTGGCCT CCACCGCCGG GAGGGTGGCG ACGGCGAGCG TCACCGACGT GGTGAGGATG ATCCGGGAGG GGAAGAAGCG
GCTCCCGTCG GAGTTCGCGC GGTGGGCCGC CGGAGAGATG GCCGGAGTCG ACCCGTACCA GATCACCTCC GACTACCGGA
CGCTGCTGGT CTCCGACTGG ACGCGGCTGG GCTTCGCCGA GGTGGACTAC GGGTGGGGCC CACCGGGCCA CGTCGTGCCG
CTCACGAACC TGGACTACAT CGCCACGTGT ATCCTCGTCA AGCCCTGGGC CCACAAACCA GGGGCACGGC TCATCACCCA
GTGCGTCACA CCCGACCGCG TCACCGCCTT CCACGACGCC ATGGTGGACA TCAACTAATT TATTATTATA ATTATAATTA
TTATTATTAT TATTATTCCC TTTTCTTTTT ATTTTATTTT TTTTACCACG CCACCTTTTT CACTTTGTTT TTTTACCACT
ACTTCCTTAT AATTAATTAA TTAATTAATT AGATATTAAT AATGAAGAAT TAAGGGTAAA AAAAGGAGAG GATAAAGAAA
GGTGAAAAGT ACATATTGAT ATTGAGGGTA CAGGTAGATG GTAGTAGTTG TTGGCATTAT TAGTGGGATT GGTATTGGAT
TCCTTTGGTG TTGTTTGGTC AAGTGTATAC TGGAGAACAG CTACTACATG CTGGGTATTC CTTTTATTTT TTTTTCTTTT
TTTTGGGATC AAAAGCTGGA ATTGGTGGGA AGCCACCAAC TAACCAGTAT GTCCCCCTTG ATAAGTGTAC CATATATTGT
ATTCAATTTT TATCTTATTT TCAGAATGGT ATATATAAGC TGGCAAGGTG TACAGCCTCT TTAGTTG