Os05t0180600-01

Locus

Os05g0180600

Description

Similar to Phosphatidylinositol 3-kinase, root isoform.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK111532 (DDBJ, Best hit)

Protein Evidence

P42347 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: phosphatidylinositol phosphorylation (GO:0046854)

Biological Process: phosphatidylinositol-mediated signaling (GO:0048015)

Cellular Component: phosphatidylinositol 3-kinase complex (GO:0005942)

Molecular Function: inositol or phosphatidylinositol kinase activity (GO:0004428)

Molecular Function: binding (GO:0005488)

Molecular Function: protein binding (GO:0005515)

Molecular Function: 1-phosphatidylinositol-3-kinase activity (GO:0016303)

Functional domain (InterPro)

Phosphoinositide 3-kinase, accessory (PIK) domain (IPR001263)

Phosphoinositide 3-kinase, C2 (IPR002420)

C2 calcium/lipid-binding domain, CaLB (IPR008973)

Phosphatidylinositol Kinase (IPR015433)

Armadillo-type fold (IPR016024)

Full-length cDNA

J013031M08 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0180600-01)

Transcript

1456 bp

>Os05t0180600-01 Similar to Phosphatidylinositol 3-kinase, root isoform.
TCTCCAACTCGCGATCCCCAACCTCCTCCTCCTCCTCGCCGCCGACTCGCCGGCGACGCC
ACCTCCCTCCCAGCGCCGCCGCAACGCAAACCGTCTTGGTTGGCCTCGCGCACGTCTCTA
GCGACGCCAGCTCGGCTCCTGCCTCCAGGAAATCGCGGACGTCGGCGTCGCCCAAGCAGG
GCCCAGGGCGCGGCTGGTGCTGGACGCCGCCGCCGCCCCACGCTGAAGCAGGCGAAGGGA
GCGTCCGGCGCAGGTCTGGACTGGGCCCGTGGTGGCGTCGCCACGCGGCGGCAATCCGCC
AGCAGCGCCATGGCGAACGGCGGCGAGTTCCGCTTCTTCCTCTCATGCGACATCAGCCTC
CCGCTCGCCTTCCGCGTCGACCGCCTCCTCCACTACCCCACGCCCACCCAGCCTTCTCCT
CCTCAAGATTGTACAACCTTGGCGACCAACAAGAAGGTTCCGGAGCTTGTTGTTGAGTGC
AAACTCTACATCGATGGGATACAATTCGGCTTGCCCGTGAGCACGAGGCTCGAATCGTCA
GGGCCACCATACTTCTGGAACGAGGTTATGACGCTCACCGCGAAATACAGGGATCTCACC
TCCCTTTCGCAGCTTGCGTTCACGGTTTGGGATATGTCATCTGGTGAGGACGGAAATATT
GTTGGTGGAGCCACCATATTTCTTTTCAACAACAAAAAGCAACTTAAAACAGGAAGGCAG
AAGCTGCGACTATGGCCCCAAAAGGAGGCAGATGGAAGAGTCCCCACCACGACTCCTGGC
AAGGTACCTAAGAATGAGAGGGGTGAGATAGAGCGTTTGGAGAGGCTTGTTAATAAGCAT
GAAAGAGGACAGATACAACATGTAGAATGGTTGGATCGTCTTTTCTTCAGAGCCATGGAC
AAAGCTAAGGAGAAGTGTGAAAGAACTGAAAATTTGTACCCTAGCCTTGTTGTTGAATTT
TGCAGTTTTGAACACAGAGTTGTCTTCCAGGAATCTGGAGCAAATTTCTATGCACCAGCC
CCTGTGTTGTTATCAAATCAACTTGTTACTGTATGGGACCCTGAACTAGGAAGAACCAAT
CCATCTGAGCACAAACAGTTAAAGCTTGCAAGGAGCCTAACTCGTGGAATAATTGATAAA
GATCTGAAACCAAGCTCAAATGAGCGAAAGTGTCTGCAAAGAATTATCAAGTTTCCTCCT
ACACGCTCTTTACAAGTGGATGAGAAGCAGCTGGTCTGGAAATTTCGGTTCTCTTTGATG
TCTGAGAAGAAAGCTCTTACAAAGTTTGTTCGTGCAGTGGACTGGAGCGATATCCAAGAA
GCTAAACAAGCTGTTGAATTGATTAGAAAGTGGGAAACAATTGATGTGGCTGATGCATTA
GAGCTTCTCTCACCAGACTTTGAAAGTGAGGAGGTTCGAGCTTATGCCGTCAACATACTT
GAAAGGGCAGATGATG

CDS

1147 bp

>Os05t0180600-01 Similar to Phosphatidylinositol 3-kinase, root isoform.
ATGGCGAACGGCGGCGAGTTCCGCTTCTTCCTCTCATGCGACATCAGCCTCCCGCTCGCC
TTCCGCGTCGACCGCCTCCTCCACTACCCCACGCCCACCCAGCCTTCTCCTCCTCAAGAT
TGTACAACCTTGGCGACCAACAAGAAGGTTCCGGAGCTTGTTGTTGAGTGCAAACTCTAC
ATCGATGGGATACAATTCGGCTTGCCCGTGAGCACGAGGCTCGAATCGTCAGGGCCACCA
TACTTCTGGAACGAGGTTATGACGCTCACCGCGAAATACAGGGATCTCACCTCCCTTTCG
CAGCTTGCGTTCACGGTTTGGGATATGTCATCTGGTGAGGACGGAAATATTGTTGGTGGA
GCCACCATATTTCTTTTCAACAACAAAAAGCAACTTAAAACAGGAAGGCAGAAGCTGCGA
CTATGGCCCCAAAAGGAGGCAGATGGAAGAGTCCCCACCACGACTCCTGGCAAGGTACCT
AAGAATGAGAGGGGTGAGATAGAGCGTTTGGAGAGGCTTGTTAATAAGCATGAAAGAGGA
CAGATACAACATGTAGAATGGTTGGATCGTCTTTTCTTCAGAGCCATGGACAAAGCTAAG
GAGAAGTGTGAAAGAACTGAAAATTTGTACCCTAGCCTTGTTGTTGAATTTTGCAGTTTT
GAACACAGAGTTGTCTTCCAGGAATCTGGAGCAAATTTCTATGCACCAGCCCCTGTGTTG
TTATCAAATCAACTTGTTACTGTATGGGACCCTGAACTAGGAAGAACCAATCCATCTGAG
CACAAACAGTTAAAGCTTGCAAGGAGCCTAACTCGTGGAATAATTGATAAAGATCTGAAA
CCAAGCTCAAATGAGCGAAAGTGTCTGCAAAGAATTATCAAGTTTCCTCCTACACGCTCT
TTACAAGTGGATGAGAAGCAGCTGGTCTGGAAATTTCGGTTCTCTTTGATGTCTGAGAAG
AAAGCTCTTACAAAGTTTGTTCGTGCAGTGGACTGGAGCGATATCCAAGAAGCTAAACAA
GCTGTTGAATTGATTAGAAAGTGGGAAACAATTGATGTGGCTGATGCATTAGAGCTTCTC
TCACCAGACTTTGAAAGTGAGGAGGTTCGAGCTTATGCCGTCAACATACTTGAAAGGGCA
GATGATG

Protein

382 aa

>Os05t0180600-01 Similar to Phosphatidylinositol 3-kinase, root isoform.
MANGGEFRFFLSCDISLPLAFRVDRLLHYPTPTQPSPPQDCTTLATNKKVPELVVECKLY
IDGIQFGLPVSTRLESSGPPYFWNEVMTLTAKYRDLTSLSQLAFTVWDMSSGEDGNIVGG
ATIFLFNNKKQLKTGRQKLRLWPQKEADGRVPTTTPGKVPKNERGEIERLERLVNKHERG
QIQHVEWLDRLFFRAMDKAKEKCERTENLYPSLVVEFCSFEHRVVFQESGANFYAPAPVL
LSNQLVTVWDPELGRTNPSEHKQLKLARSLTRGIIDKDLKPSSNERKCLQRIIKFPPTRS
LQVDEKQLVWKFRFSLMSEKKALTKFVRAVDWSDIQEAKQAVELIRKWETIDVADALELL
SPDFESEEVRAYAVNILERADD

5'UTR

chr05:4865302..4865610 (- strand) : 309 bp

CDS

chr05:4865184..4865301 (- strand) : 118 bp

chr05:4863274..4863373 (- strand) : 100 bp

chr05:4863091..4863187 (- strand) : 97 bp

chr05:4861964..4862122 (- strand) : 159 bp

chr05:4861517..4861723 (- strand) : 207 bp

chr05:4860854..4861032 (- strand) : 179 bp

chr05:4860423..4860570 (- strand) : 148 bp

chr05:4859253..4859348 (- strand) : 96 bp

chr05:4859051..4859093 (- strand) : 43 bp

FASTA

>Os05t0180600-01 class=Sequence position=chr05:4859051..4865610 (- strand)
TCTCCAACTC GCGATCCCCA ACCTCCTCCT CCTCCTCGCC GCCGACTCGC CGGCGACGCC ACCTCCCTCC CAGCGCCGCC
GCAACGCAAA CCGTCTTGGT TGGCCTCGCG CACGTCTCTA GCGACGCCAG CTCGGCTCCT GCCTCCAGGA AATCGCGGAC
GTCGGCGTCG CCCAAGCAGG GCCCAGGGCG CGGCTGGTGC TGGACGCCGC CGCCGCCCCA CGCTGAAGCA GGCGAAGGGA
GCGTCCGGCG CAGGTCTGGA CTGGGCCCGT GGTGGCGTCG CCACGCGGCG GCAATCCGCC AGCAGCGCCA TGGCGAACGG
CGGCGAGTTC CGCTTCTTCC TCTCATGCGA CATCAGCCTC CCGCTCGCCT TCCGCGTCGA CCGCCTCCTC CACTACCCCA
CGCCCACCCA GCCTTCTCCT CCTCAAGGTC ACCACCCCAT TCCTTTCCTT TTTCTAGTAT TAGCAATTCT TAATTCTCTC
ACACATGTAG TAACCAGTAT CAAATTAATA CTAGATGATA CCCTGCGTGT TGCTGCGTGT TGCTGCGGGA TATTTGAATA
ACTATAGTAA AAATATAAAC TTTACGAACT TTGAACATGT TGCATCAGGG CTTTTTTTTT TTTGGAAAAA AAAGGATATA
TTGTGAAATC ATAATAAAAG AAAAGCTAAA CAACAAAATA GTTATGAATC CAATTAATCC ATAAATCACC AAGAACAAAA
AAAAAAATGA TGGTATATGA TGATGTCGTT CATGATTACT CCTTAATGAA CAAAATAAGC AAGACATAGC GGAGGAGACC
CATACTTTAT GAATTATGAT TGATCATCAC ATAAAAGAAC TCTAGAACAA ATAGTTCAAA TGAAAAAAAA GCTATCATCA
AGGTAATTCA CATAATTTTA GGAGAGCACC AAGTTAATAA AATCAGCTAC AGTATAAAAT GTAAAGACTT ATCAAACTTG
TGATCAACAG TGCTACATAT CTGCACCAAA ATGTATGCCT AATAATCCAA AAGGCTTCAC ACAGTGACAG TCATTAGCAA
TGCAGTTGCT GGCCGGACAT GAGCGGCATA GTGGCAAACC TGCAATAGTG GCAATGGAGA CAAAACACCA ATCTAATATC
TGTAAAGCAT GGCTATGTGC GAGGCAAAAG CTGGTATTTT ATTCTATTAT CTAAAAAAAT ATCTGTAAAG CAACCAAAAA
TGAAAAATAT AACCAATGCA ATACAGTTTG TGTTGAGAGA GGAAAATACC TGCTGCCGTG CATGTGACAG AGTGCATTAT
CTAACCTGAA GAAACAAAAT AGGGCATGCC AATACTATTC CCTTTACGCT AGTGTTATAT ATACAACATG GCTTCTCGAT
CGACAGTTTC CTTGATCATT GTATGGATCA GTGGATGCCA TCGCTCGATT GTATAGACAT GAAGCAGCAG AAATTGAAGG
CATGATAGGA AATGTATAGT TAGCAATAGA AAAAAAAACA GACGGGAATT CATGTAATCC TCCATGGAAC AAACCTGCAA
AGAAAGTGAA GTAATCCTAA GAAGAGATTG AAAGGAGTGA CTTTCCACTG GCACAAATAG TGCTCCAAGG GAGAGATAAA
AAAAAATAGA GAGAAAGAAG AGGATGAAGG TATTAAGACC ATTAAAAAGT AAAAACATGG CGGATATTAC AAACTATTCA
AAACATGGCC CAATCTGCAT CAATCAAAAT ATAGTTTATA AAGAGACATT TAGATATTTA GCTGGACTGA GGATGAACCT
ACAATGGAAA TAATGGATAT CGTGGCATGG AAAGAGATAA CCTCCTCCAG TCCTCGTAGT CATCCAGGAA GCAGCAGCAT
CAACCTTCAT ACTCACTTCT CTTCTTGAAT CATAATTAGC AGAACAACTC GCGTGTCGTA ATATAAAAGA AGATGAGAAG
GGAGGAGACG TTCCAAACTT CCAATAATGC AAGCAGTGGT TATTAGAAGG TGAAGATTAA AAGGCAAAAG TGGAGGCAGC
CGGTGACCCT TCGCTCCCTA CCGCATCTAT AGAACCGAGC AGGGCAGGAA GGACTGCAAA AAAATCTGAT CGGTTAAAGC
AGACCGATCC GATGGACGGG AATAGACAGT GACGTGGCAA AGCGAGAGAG CAGGAAAATA GAATTAGTGG GGATGACTTG
TATAGGTATA TAGGATTAAG CTCATGACAA TTACTGACTG TGAATCTGTG ATCCTATTTG GCATTCTTGT TTGTCAGATT
GTACAACCTT GGCGACCAAC AAGAAGGTTC CGGAGCTTGT TGTTGAGTGC AAACTCTACA TCGATGGGAT ACAATTCGGC
TTGCCCGTGA GCACGAGGTA TCCCCTTTTT GTTTTCTGTT ATCTAAACGC ATTGAAATGT AATAACTCTC TCATCGAATC
TTCGTTACGC GCTTACATGC TAGGCTCGAA TCGTCAGGGC CACCATACTT CTGGAACGAG GTTATGACGC TCACCGCGAA
ATACAGGGAT CTCACCTCCC TTTCGCAGCT TGCGTTCACG GTATGTTTCC TTGTCTTCAG ACGCCAAAAG TTATCAAGCT
ACAAGATACT ATCTTTGGGA ATGCATGGGG TGATATCTTC GGTAGGGATT TGTTCCAACA ACATACTTAG TGTTAAAAAA
TGAGTTGTCG GTGTATGGGA TAGTTTGAAG TGAACACTAT TATTTGTGAG GATGGGTAGT CATGCACGGT GTATGGTGAA
CTAACCACCC TACTGATTGA CTAGTTCCAG GGTTAGGCAT AAATGCATTT CCTCTTTTGG GCGGTGGAAA TTGTATGTAT
GTAAGGATCA TATCTGATGA AGTTCggggg tgtttggttg atggctaagt ttgtcaaacc acaacttaag caagttgtgg
cttgccacat ggccacactt gaggcaaata gtatgaaaac aagccattga catgtggggc catgtgaatg aagggggtgt
ggctagccac gattatggca gttaactaaa gacaTGCCTA AGGACCTATG TCATTGGTGC AAAATTCTGG CTTTTCATTC
TTTTCGGAGG TGGCATGTTG TCTTAGCATC TCTTGGCCAA GTTTATTGGA GATGAGCATG GTTTTTCAAT AAGAACTTGA
AGTCCTCTTG AAGCGACAGT ACTGTTTTGC TATGCCCAGC AAACTTACTT TGGTGCTGCC TGCCATGAGT TTCCATTAGT
CAGTGTTGAG CTCAAACCCT TTTCACCTAG ATGATTTAAG AGTGGCGGCG AGCATCTCTT CTATTGGCCT ATTGTTGGTT
CAAGCTCCCT TCAGTTCTAT GTGTTGCTTT ATTTGTCTCC TTGTTGTGCA TCTTTGTGCT TTTCTTAAAA AAAAAAAATC
TTGTAAGACT CATGTTTGCT TCATTTATAT TAATATACTC ACACACAAGG CTGTTGCTTG TTCCTTAAAA AGGAATATGT
TTATCTCTTG CACTTATCTT CCTATGCTTT CCATCTGGAA TATTGTAGGT TTGGGATATG TCATCTGGTG AGGACGGAAA
TATTGTTGGT GGAGCCACCA TATTTCTTTT CAACAACAAA AAGCAACTTA AAACAGGAAG GCAGAAGCTG CGACTATGGC
CCCAAAAGGA GGCAGATGGA AGAGTCCCCA CCACGACTCC TGGCAAGGTT GTAATATTGT ATGAAGAGCT CAATTTGCTT
TTGGGTCAGG ATGTGCTTCT TGACCTTTTA TActatgttt tctccttctt aatgaaatga cacacaactc tcctgcgttg
ttctaaaaat aaTTTGCTTC TAATGCCCTT TTGATTCTGA TCTGCTCACT AATCTCTCAA TCTAATGGTT ATTACATCTC
TTCCGTACAG TGAACTTACC CTCTTTTTGT TCCTATTACA CATGTAGGTA CCTAAGAATG AGAGGGGTGA GATAGAGCGT
TTGGAGAGGC TTGTTAATAA GCATGAAAGA GGACAGATAC AACATGTAGA ATGGTTGGAT CGTCTTTTCT TCAGAGCCAT
GGACAAAGCT AAGGAGAAGT GTGAAAGAAC TGAAAATTTG TACCCTAGCC TTGTTGTTGA ATTTTGCAGT TTTGAACACA
GAGTTGTCTT CCAGGTTATC TTTTCTTCGC CACTGAGTTT ACATATGTCT TTCATCTCTC TTTTTCATTA TGAATTTGCC
GTAATATTTT CAAGTTCTCT TAGTATAAAT ATATAATACT GTACATGTAG TGTGACATAA TGTTTACAAT CTAGCATAGT
CTATACTTTG GAAGTTATAT TGAGCGCATA ATCTATGAAA TACACCATCA TAGTTAATAT CTTTCTGAGT TGAAGCATGC
TTTTTGCCAT TTGGTTGGTT CAGTGCAATC CATTGTTTAA CTGAATAATA TTTTATTCTA GTTACTCTTT TCTTTTCTTT
TTGTTGTTGG ATAAATTGTC GACATTTTGA TTTTTACCAT AGTTTTTTCT TGTAATTGGT CATGGATCAT GGATGGATTA
TCATTTTTTT TTGTTAAGTG TAGAGTCATT TAATATTTAC CGATTTATAA TATGTTCATC TCTGCTATAG AAGTTTTTAT
CAAATTTTCC ACATGCAGGA ATCTGGAGCA AATTTCTATG CACCAGCCCC TGTGTTGTTA TCAAATCAAC TTGTTACTGT
ATGGGACCCT GAACTAGGAA GAACCAATCC ATCTGAGCAC AAACAGTTAA AGCTTGCAAG GAGCCTAACT CGTGGAATAA
TTGATAAAGA TCTGAAACCA AGCTCAAATG AGCGAAAGTG AGTGCAAATT GTATTTTATT CTTTCCTCCT TGTCTTGTCA
CCTTATAATG TTTTTTAGCC TTTTATCTCT ATAACATGAT GGTGAATCTT GGCATCGTGT AATTTTTACA GTGGTTGCTC
TAATCTCTTA AATTTTTCAA CACAAAATTG TGAGGCAACC AATTTGCATC CAGTTCCAGC TTCTTTAATT AGGAGTGACA
GGAATAAAAC TTCAATTCTG ATTAGCACTA ATTTGAATTC ATGGATTTTT TTTTACCTAA ATCTAGTACT CTATGTCTAG
GTGTCTGCAA AGAATTATCA AGTTTCCTCC TACACGCTCT TTACAAGTGG ATGAGAAGCA GCTGGTCTGG AAATTTCGGT
TCTCTTTGAT GTCTGAGAAG AAAGCTCTTA CAAAGTTTGT TCGTGCAGTG GACTGGAGCG ATATCCAAGT TAGTAAAAGC
ATCCACACAT CTTATTGCCG TTTTTGCATT GTATTGCCAT ATTTTTTATT AGGATCAGTG GACTGGAGGA TGTCCCTTTG
CATGCCTGTG TGTTCTTCAC TTCTTTGGCT TGTTGGAACT GTTAGGAATA TGGCCTGTTT GACGAAAATT GAGAGTTCAC
AGGGAATGGG AGTTCAAATG AGAGTTTATG GTGAATTAGT CTTGAGTTTT TTTTTTTTTT TTGGTTTCCA CCTTGCCTGG
TTAGTGAGAT GAGAAGTTAC AGTGAATTAG TGTGGAGACT ATTTTAAGTC ATGATGAAGG GCTGGGATTT ATCCATCTTA
ACATAAAGAT GGATTTCCAT CCCAATTCCT GGCCCCTGCT AGGTATTAAA ATAGTGGAGT TAGCCCTCAA ATTCCCCACT
GCCATCCTAT CTGAAGTTCT AAACTCCAAT GCCAGTTATA CCCAACAGGT GTTTAGCAAC AATTgggaag aggattggga
ctttgaagta gggattcatg acagattagt cttgagagtt tgttttttta attcttgatc ccttgtttgg caaagagtgt
aatcacaagg aattgctgaa aatactgttt tttaagtgat gatgaagggc taggatttgc ctcatctcta cataagaaag
caattcgcac cccttcccca tgtattaaaa gtgtgggagt tagccccctc aaactctgtc cctatcccac ctaaactccc
attcctggca aacaaacaaa atgtttcata acctccaccc tctaaagtcc catctcctct aaacaatttc cctcatccaa
acAAGCTAAC AACGAAATTA ATAACCCAAC TCCCTCCCAT TCCGTCGCAA TAATTTGCCT TACCAAACAA GCTGTTAAGG
CCAGGGAAAA TGATACACGG ATGTTCATTG CAACTAGATT TTGTGATGTC GCAGTATCAT TTCAAGTTTA TTTCTAAGAA
ATTTCCTCAT TATCTTTAGA TCTGTCAACT CCTCATTTTC TTGATCTAAT GTCTATGTGG TTTGGTAGCT TCTTATAATT
AGTATGTGAT AATGCCATGC AGGAAGCTAA ACAAGCTGTT GAATTGATTA GAAAGTGGGA AACAATTGAT GTGGCTGATG
CATTAGAGCT TCTCTCACCA GACTTTGAAA GTGAGGAGGT GAGCTTTTTA TCTAACCTTT GTCTGTGGAT GCTTCTTGTT
TTCTTAGAAG AGTACGTGCT AGGGTGGTTT TCATGTAGTT GGCATTGGCA CATGGCACTG TGTGACTGGA AGGATATATT
TATCATTTCT GTAACATATC CATTTTTTGG CGCAAAGGTT CGAGCTTATG CCGTCAACAT ACTTGAAAGG GCAGATGATG

Locus: Os05g0180600

Loading...

Locus: Os05g0180600

Loading...