Os05t0180600-02

Locus

Os05g0180600

Description

Similar to Phosphatidylinositol 3-kinase, root isoform (EC 2.7.1.137) (PI3- kinase) (PtdIns-3-kinase) (PI3K) (SPI3K-5).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK111613 (DDBJ, Best hit)

Protein Evidence

P42347 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: phosphatidylinositol phosphorylation (GO:0046854)

Biological Process: phosphatidylinositol-mediated signaling (GO:0048015)

Cellular Component: phosphatidylinositol 3-kinase complex (GO:0005942)

Molecular Function: inositol or phosphatidylinositol kinase activity (GO:0004428)

Molecular Function: binding (GO:0005488)

Molecular Function: protein binding (GO:0005515)

Molecular Function: 1-phosphatidylinositol-3-kinase activity (GO:0016303)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Molecular Function: phosphotransferase activity, alcohol group as acceptor (GO:0016773)

Functional domain (InterPro)

Phosphatidylinositol 3-/4-kinase, catalytic (IPR000403)

Phosphoinositide 3-kinase, accessory (PIK) domain (IPR001263)

Phosphoinositide 3-kinase, C2 (IPR002420)

Phosphatidylinositol 3-kinase, Vps34 type (IPR008290)

C2 calcium/lipid-binding domain, CaLB (IPR008973)

Protein kinase-like domain (IPR011009)

Phosphatidylinositol Kinase (IPR015433)

Armadillo-type fold (IPR016024)

Phosphatidylinositol 3/4-kinase, conserved site (IPR018936)

Full-length cDNA

J013099I11 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0180600-02)

RiceXPro (AK111613)

Others

KEGG (Os05t0180600-02 (EC:2.7.1.137))

Transcript

3063 bp

>Os05t0180600-02 Similar to Phosphatidylinositol 3-kinase, root isoform (EC 2.7.1.137) (PI3- kinase) (PtdIns-3-kinase) (PI3K) (SPI3K-5).
CGATCCCCAACCTCCTCCTCCTCCTCGCCGCCGACTCGCCGGCGACGCCACCTCCCTCCC
AGCGCCGCCGCAACGCAAACCGTCTTGGTTGGCCTCGCGCACGTCTCTAGCGACGCCAGC
TCGGCTCCTGCCTCCAGGAAATCGCGGACGTCGGCGTCGCCCAAGCAGGGCCCAGGGCGC
GGCTGGTGCTGGACGCCGCCGCCGCCCCACGCTGAAGCAGGCGAAGGGAGCGTCCGGCGC
AGGTCTGGACTGGGCCCGTGGTGGCGTCGCCACGCGGCGGCAATCCGCCAGCAGCGCCAT
GGCGAACGGCGGCGAGTTCCGCTTCTTCCTCTCATGCGACATCAGCCTCCCGCTCGCCTT
CCGCGTCGACCGCCTCCTCCACTACCCCACGCCCACCCAGCCTTCTCCTCCTCAAGATTG
TACAACCTTGGCGACCAACAAGAAGGTTCCGGAGCTTGTTGTTGAGTGCAAACTCTACAT
CGATGGGATACAATTCGGCTTGCCCGTGAGCACGAGGCTCGAATCGTCAGGGCCACCATA
CTTCTGGAACGAGGTTATGACGCTCACCGCGAAATACAGGGATCTCACCTCCCTTTCGCA
GCTTGCGTTCACGGTTTGGGATATGTCATCTGGTGAGGACGGAAATATTGTTGGTGGAGC
CACCATATTTCTTTTCAACAACAAAAAGCAACTTAAAACAGGAAGGCAGAAGCTGCGACT
ATGGCCCCAAAAGGAGGCAGATGGAAGAGTCCCCACCACGACTCCTGGCAAGGTACCTAA
GAATGAGAGGGGTGAGATAGAGCGTTTGGAGAGGCTTGTTAATAAGCATGAAAGAGGACA
GATACAACATGTAGAATGGTTGGATCGTCTTTTCTTCAGAGCCATGGACAAAGCTAAGGA
GAAGTGTGAAAGAACTGAAAATTTGTACCCTAGCCTTGTTGTTGAATTTTGCAGTTTTGA
ACACAGAGTTGTCTTCCAGGAATCTGGAGCAAATTTCTATGCACCAGCCCCTGTGTTGTT
ATCAAATCAACTTGTTACTGTATGGGACCCTGAACTAGGAAGAACCAATCCATCTGAGCA
CAAACAGTTAAAGCTTGCAAGGAGCCTAACTCGTGGAATAATTGATAAAGATCTGAAACC
AAGCTCAAATGAGCGAAAGTGTCTGCAAAGAATTATCAAGTTTCCTCCTACACGCTCTTT
ACAAGTGGATGAGAAGCAGCTGGTCTGGAAATTTCGGTTCTCTTTGATGTCTGAGAAGAA
AGCTCTTACAAAGTTTGTTCGTGCAGTGGACTGGAGCGATATCCAAGAAGCTAAACAAGC
TGTTGAATTGATTAGAAAGTGGGAAACAATTGATGTGGCTGATGCATTAGAGCTTCTCTC
ACCAGACTTTGAAAGTGAGGAGGTTCGAGCTTATGCCGTCAACATACTTGAAAGGGCAGA
TGATGAAGAATTACAATGCTATTTACTCCAGCTAGTGCAAGCTCTTCGGTTTGAAAGATC
GGATGAGTCTTGTCTGGCACACTTTCTTGTAAAACGTGCTGTATCAAACATTGAAATTGC
TAGCTTCCTTCGCTGGTATGTGGTCGTTGAGCTGCGTGACACTGCATATGCAAGACGGTA
TTACAGTACATATGACTTGCTTGAAAATGGCATGATGAAATTTGCTAGGGATGATGGTGA
TGAAGACGGATTTCGACTTTGGCAGAGTTTAACACGGCAGACTGAACTTATGGCTCAGTT
AGGTTCTATTATGAAGGATGTAAAACAAGTTCGTGGTAGTGCACAAAAGAAAATCGATGG
ATTAAGACAATTATTATCAGGAGTTTTCAGTGAGCTTACCAACTTTGATGAGCCAATTCG
TTCACCATTAGCACCAACTGTTCTCCTTACTGGGGTTATACCTCAAGAATCATCTATATT
TAAAAGTGCCTTGCATCCTTTGCGCCTTGCCTTTAAGACCGCAAATGGGGGAATATCGAA
GATAATTTATAAAAAGGGAGATGATCTCCGCCAAGATCAGCTGGTTATTCAAATGGTCTC
CTTGATGGACCGGCTGCTCAAATTAGAAAATATGGATTTACACCTTACTCCATATCGAGT
TCTTGCAACTCAACCAGATGAAGGAATGCTTGAATTTATTCCTTCCAGTTCACTTGCACA
GATTCTATCAGAACATCGCACTATTACAAGTTACCTACAAAAATTTCATCCTGATGAAGA
TGGTCCTTTTGGTATAACTGCTCAGTGCTTGGAAACTTTCATAAAAAGCTGTGCTGGTTA
CTCTGTCATTACATATATAATGGGGGTTGGAGACAGGCATCTGGATAATCTTCTTCTAAC
AGATGATGGACGCCTCTTCCACGTTGATTTCGCTTTCATTCTGGGTAAAGATCCAAAGCC
ATTTCCACCACCAATGAAACTATGCAAAGAAATGGTTGAGGCCATGGGTGGTGCAGAAAG
CCAATACTACACGAGATTCAAGTCATACTGTTGCGAAGCATACAACATTTTAAGGAAGTC
CAGTAGCCTCATATTGAATCTGTTCAACTTGATGAGAAGATCAAATATTCCAGACATCAC
TAACGAGGAAAATGCAGGCCTTAAGCTTCAAGAGAAATTTCGGCTTGATCTGGAAGATGA
GGAAGCCATACATTTCTTCCAAGATCTTATCAACGAAAGCGTCAGCGCTTTGTTCCCTCA
GATGGTTGAGACAATCCATAGATGGGCTCAATACTGGCGCTAAGCAAAGTCGGTAACAGG
CATGATTGATGTATATACGTACTAACATGCTCGCCTGCGACCGATTTATTTGCAGCAGGT
TGCAGGTCTGAACTCTGAATCCATTTACATTTGTCGATAGCTTAGTTTGTGAATATACCA
CGCATGCGCCTGGTTAGAAAGCTATTGAATGTAGACAGAAGTGTAATAAGGCTAGCAGTA
TTAAAAAAAGAATCTTTAGCGGCAAATATAATAATGTTTTATGTGCCTCAACCCTGACAA
TTTTATGCTTCTTTTTGTAAGTTTGGAGAATTCGAACGTAGAAAATAAAATAAACTATTT
ATT

CDS

2445 bp

>Os05t0180600-02 Similar to Phosphatidylinositol 3-kinase, root isoform (EC 2.7.1.137) (PI3- kinase) (PtdIns-3-kinase) (PI3K) (SPI3K-5).
ATGGCGAACGGCGGCGAGTTCCGCTTCTTCCTCTCATGCGACATCAGCCTCCCGCTCGCC
TTCCGCGTCGACCGCCTCCTCCACTACCCCACGCCCACCCAGCCTTCTCCTCCTCAAGAT
TGTACAACCTTGGCGACCAACAAGAAGGTTCCGGAGCTTGTTGTTGAGTGCAAACTCTAC
ATCGATGGGATACAATTCGGCTTGCCCGTGAGCACGAGGCTCGAATCGTCAGGGCCACCA
TACTTCTGGAACGAGGTTATGACGCTCACCGCGAAATACAGGGATCTCACCTCCCTTTCG
CAGCTTGCGTTCACGGTTTGGGATATGTCATCTGGTGAGGACGGAAATATTGTTGGTGGA
GCCACCATATTTCTTTTCAACAACAAAAAGCAACTTAAAACAGGAAGGCAGAAGCTGCGA
CTATGGCCCCAAAAGGAGGCAGATGGAAGAGTCCCCACCACGACTCCTGGCAAGGTACCT
AAGAATGAGAGGGGTGAGATAGAGCGTTTGGAGAGGCTTGTTAATAAGCATGAAAGAGGA
CAGATACAACATGTAGAATGGTTGGATCGTCTTTTCTTCAGAGCCATGGACAAAGCTAAG
GAGAAGTGTGAAAGAACTGAAAATTTGTACCCTAGCCTTGTTGTTGAATTTTGCAGTTTT
GAACACAGAGTTGTCTTCCAGGAATCTGGAGCAAATTTCTATGCACCAGCCCCTGTGTTG
TTATCAAATCAACTTGTTACTGTATGGGACCCTGAACTAGGAAGAACCAATCCATCTGAG
CACAAACAGTTAAAGCTTGCAAGGAGCCTAACTCGTGGAATAATTGATAAAGATCTGAAA
CCAAGCTCAAATGAGCGAAAGTGTCTGCAAAGAATTATCAAGTTTCCTCCTACACGCTCT
TTACAAGTGGATGAGAAGCAGCTGGTCTGGAAATTTCGGTTCTCTTTGATGTCTGAGAAG
AAAGCTCTTACAAAGTTTGTTCGTGCAGTGGACTGGAGCGATATCCAAGAAGCTAAACAA
GCTGTTGAATTGATTAGAAAGTGGGAAACAATTGATGTGGCTGATGCATTAGAGCTTCTC
TCACCAGACTTTGAAAGTGAGGAGGTTCGAGCTTATGCCGTCAACATACTTGAAAGGGCA
GATGATGAAGAATTACAATGCTATTTACTCCAGCTAGTGCAAGCTCTTCGGTTTGAAAGA
TCGGATGAGTCTTGTCTGGCACACTTTCTTGTAAAACGTGCTGTATCAAACATTGAAATT
GCTAGCTTCCTTCGCTGGTATGTGGTCGTTGAGCTGCGTGACACTGCATATGCAAGACGG
TATTACAGTACATATGACTTGCTTGAAAATGGCATGATGAAATTTGCTAGGGATGATGGT
GATGAAGACGGATTTCGACTTTGGCAGAGTTTAACACGGCAGACTGAACTTATGGCTCAG
TTAGGTTCTATTATGAAGGATGTAAAACAAGTTCGTGGTAGTGCACAAAAGAAAATCGAT
GGATTAAGACAATTATTATCAGGAGTTTTCAGTGAGCTTACCAACTTTGATGAGCCAATT
CGTTCACCATTAGCACCAACTGTTCTCCTTACTGGGGTTATACCTCAAGAATCATCTATA
TTTAAAAGTGCCTTGCATCCTTTGCGCCTTGCCTTTAAGACCGCAAATGGGGGAATATCG
AAGATAATTTATAAAAAGGGAGATGATCTCCGCCAAGATCAGCTGGTTATTCAAATGGTC
TCCTTGATGGACCGGCTGCTCAAATTAGAAAATATGGATTTACACCTTACTCCATATCGA
GTTCTTGCAACTCAACCAGATGAAGGAATGCTTGAATTTATTCCTTCCAGTTCACTTGCA
CAGATTCTATCAGAACATCGCACTATTACAAGTTACCTACAAAAATTTCATCCTGATGAA
GATGGTCCTTTTGGTATAACTGCTCAGTGCTTGGAAACTTTCATAAAAAGCTGTGCTGGT
TACTCTGTCATTACATATATAATGGGGGTTGGAGACAGGCATCTGGATAATCTTCTTCTA
ACAGATGATGGACGCCTCTTCCACGTTGATTTCGCTTTCATTCTGGGTAAAGATCCAAAG
CCATTTCCACCACCAATGAAACTATGCAAAGAAATGGTTGAGGCCATGGGTGGTGCAGAA
AGCCAATACTACACGAGATTCAAGTCATACTGTTGCGAAGCATACAACATTTTAAGGAAG
TCCAGTAGCCTCATATTGAATCTGTTCAACTTGATGAGAAGATCAAATATTCCAGACATC
ACTAACGAGGAAAATGCAGGCCTTAAGCTTCAAGAGAAATTTCGGCTTGATCTGGAAGAT
GAGGAAGCCATACATTTCTTCCAAGATCTTATCAACGAAAGCGTCAGCGCTTTGTTCCCT
CAGATGGTTGAGACAATCCATAGATGGGCTCAATACTGGCGCTAA

Protein

815 aa

>Os05t0180600-02 Similar to Phosphatidylinositol 3-kinase, root isoform (EC 2.7.1.137) (PI3- kinase) (PtdIns-3-kinase) (PI3K) (SPI3K-5).
MANGGEFRFFLSCDISLPLAFRVDRLLHYPTPTQPSPPQDCTTLATNKKVPELVVECKLY
IDGIQFGLPVSTRLESSGPPYFWNEVMTLTAKYRDLTSLSQLAFTVWDMSSGEDGNIVGG
ATIFLFNNKKQLKTGRQKLRLWPQKEADGRVPTTTPGKVPKNERGEIERLERLVNKHERG
QIQHVEWLDRLFFRAMDKAKEKCERTENLYPSLVVEFCSFEHRVVFQESGANFYAPAPVL
LSNQLVTVWDPELGRTNPSEHKQLKLARSLTRGIIDKDLKPSSNERKCLQRIIKFPPTRS
LQVDEKQLVWKFRFSLMSEKKALTKFVRAVDWSDIQEAKQAVELIRKWETIDVADALELL
SPDFESEEVRAYAVNILERADDEELQCYLLQLVQALRFERSDESCLAHFLVKRAVSNIEI
ASFLRWYVVVELRDTAYARRYYSTYDLLENGMMKFARDDGDEDGFRLWQSLTRQTELMAQ
LGSIMKDVKQVRGSAQKKIDGLRQLLSGVFSELTNFDEPIRSPLAPTVLLTGVIPQESSI
FKSALHPLRLAFKTANGGISKIIYKKGDDLRQDQLVIQMVSLMDRLLKLENMDLHLTPYR
VLATQPDEGMLEFIPSSSLAQILSEHRTITSYLQKFHPDEDGPFGITAQCLETFIKSCAG
YSVITYIMGVGDRHLDNLLLTDDGRLFHVDFAFILGKDPKPFPPPMKLCKEMVEAMGGAE
SQYYTRFKSYCCEAYNILRKSSSLILNLFNLMRRSNIPDITNEENAGLKLQEKFRLDLED
EEAIHFFQDLINESVSALFPQMVETIHRWAQYWR*

5'UTR

chr05:4865302..4865599 (- strand) : 298 bp

CDS

chr05:4865184..4865301 (- strand) : 118 bp

chr05:4863274..4863373 (- strand) : 100 bp

chr05:4863091..4863187 (- strand) : 97 bp

chr05:4861964..4862122 (- strand) : 159 bp

chr05:4861517..4861723 (- strand) : 207 bp

chr05:4860854..4861032 (- strand) : 179 bp

chr05:4860423..4860570 (- strand) : 148 bp

chr05:4859253..4859348 (- strand) : 96 bp

chr05:4858958..4859093 (- strand) : 136 bp

chr05:4858153..4858274 (- strand) : 122 bp

chr05:4857873..4858064 (- strand) : 192 bp

chr05:4857577..4857747 (- strand) : 171 bp

chr05:4856090..4856227 (- strand) : 138 bp

chr05:4855791..4855945 (- strand) : 155 bp

chr05:4855046..4855189 (- strand) : 144 bp

chr05:4854826..4854970 (- strand) : 145 bp

chr05:4854537..4854674 (- strand) : 138 bp

3'UTR

chr05:4854217..4854536 (- strand) : 320 bp

FASTA

>Os05t0180600-02 class=Sequence position=chr05:4854217..4865599 (- strand)
CGATCCCCAA CCTCCTCCTC CTCCTCGCCG CCGACTCGCC GGCGACGCCA CCTCCCTCCC AGCGCCGCCG CAACGCAAAC
CGTCTTGGTT GGCCTCGCGC ACGTCTCTAG CGACGCCAGC TCGGCTCCTG CCTCCAGGAA ATCGCGGACG TCGGCGTCGC
CCAAGCAGGG CCCAGGGCGC GGCTGGTGCT GGACGCCGCC GCCGCCCCAC GCTGAAGCAG GCGAAGGGAG CGTCCGGCGC
AGGTCTGGAC TGGGCCCGTG GTGGCGTCGC CACGCGGCGG CAATCCGCCA GCAGCGCCAT GGCGAACGGC GGCGAGTTCC
GCTTCTTCCT CTCATGCGAC ATCAGCCTCC CGCTCGCCTT CCGCGTCGAC CGCCTCCTCC ACTACCCCAC GCCCACCCAG
CCTTCTCCTC CTCAAGGTCA CCACCCCATT CCTTTCCTTT TTCTAGTATT AGCAATTCTT AATTCTCTCA CACATGTAGT
AACCAGTATC AAATTAATAC TAGATGATAC CCTGCGTGTT GCTGCGTGTT GCTGCGGGAT ATTTGAATAA CTATAGTAAA
AATATAAACT TTACGAACTT TGAACATGTT GCATCAGGGC TTTTTTTTTT TTGGAAAAAA AAGGATATAT TGTGAAATCA
TAATAAAAGA AAAGCTAAAC AACAAAATAG TTATGAATCC AATTAATCCA TAAATCACCA AGAACAAAAA AAAAAATGAT
GGTATATGAT GATGTCGTTC ATGATTACTC CTTAATGAAC AAAATAAGCA AGACATAGCG GAGGAGACCC ATACTTTATG
AATTATGATT GATCATCACA TAAAAGAACT CTAGAACAAA TAGTTCAAAT GAAAAAAAAG CTATCATCAA GGTAATTCAC
ATAATTTTAG GAGAGCACCA AGTTAATAAA ATCAGCTACA GTATAAAATG TAAAGACTTA TCAAACTTGT GATCAACAGT
GCTACATATC TGCACCAAAA TGTATGCCTA ATAATCCAAA AGGCTTCACA CAGTGACAGT CATTAGCAAT GCAGTTGCTG
GCCGGACATG AGCGGCATAG TGGCAAACCT GCAATAGTGG CAATGGAGAC AAAACACCAA TCTAATATCT GTAAAGCATG
GCTATGTGCG AGGCAAAAGC TGGTATTTTA TTCTATTATC TAAAAAAATA TCTGTAAAGC AACCAAAAAT GAAAAATATA
ACCAATGCAA TACAGTTTGT GTTGAGAGAG GAAAATACCT GCTGCCGTGC ATGTGACAGA GTGCATTATC TAACCTGAAG
AAACAAAATA GGGCATGCCA ATACTATTCC CTTTACGCTA GTGTTATATA TACAACATGG CTTCTCGATC GACAGTTTCC
TTGATCATTG TATGGATCAG TGGATGCCAT CGCTCGATTG TATAGACATG AAGCAGCAGA AATTGAAGGC ATGATAGGAA
ATGTATAGTT AGCAATAGAA AAAAAAACAG ACGGGAATTC ATGTAATCCT CCATGGAACA AACCTGCAAA GAAAGTGAAG
TAATCCTAAG AAGAGATTGA AAGGAGTGAC TTTCCACTGG CACAAATAGT GCTCCAAGGG AGAGATAAAA AAAAATAGAG
AGAAAGAAGA GGATGAAGGT ATTAAGACCA TTAAAAAGTA AAAACATGGC GGATATTACA AACTATTCAA AACATGGCCC
AATCTGCATC AATCAAAATA TAGTTTATAA AGAGACATTT AGATATTTAG CTGGACTGAG GATGAACCTA CAATGGAAAT
AATGGATATC GTGGCATGGA AAGAGATAAC CTCCTCCAGT CCTCGTAGTC ATCCAGGAAG CAGCAGCATC AACCTTCATA
CTCACTTCTC TTCTTGAATC ATAATTAGCA GAACAACTCG CGTGTCGTAA TATAAAAGAA GATGAGAAGG GAGGAGACGT
TCCAAACTTC CAATAATGCA AGCAGTGGTT ATTAGAAGGT GAAGATTAAA AGGCAAAAGT GGAGGCAGCC GGTGACCCTT
CGCTCCCTAC CGCATCTATA GAACCGAGCA GGGCAGGAAG GACTGCAAAA AAATCTGATC GGTTAAAGCA GACCGATCCG
ATGGACGGGA ATAGACAGTG ACGTGGCAAA GCGAGAGAGC AGGAAAATAG AATTAGTGGG GATGACTTGT ATAGGTATAT
AGGATTAAGC TCATGACAAT TACTGACTGT GAATCTGTGA TCCTATTTGG CATTCTTGTT TGTCAGATTG TACAACCTTG
GCGACCAACA AGAAGGTTCC GGAGCTTGTT GTTGAGTGCA AACTCTACAT CGATGGGATA CAATTCGGCT TGCCCGTGAG
CACGAGGTAT CCCCTTTTTG TTTTCTGTTA TCTAAACGCA TTGAAATGTA ATAACTCTCT CATCGAATCT TCGTTACGCG
CTTACATGCT AGGCTCGAAT CGTCAGGGCC ACCATACTTC TGGAACGAGG TTATGACGCT CACCGCGAAA TACAGGGATC
TCACCTCCCT TTCGCAGCTT GCGTTCACGG TATGTTTCCT TGTCTTCAGA CGCCAAAAGT TATCAAGCTA CAAGATACTA
TCTTTGGGAA TGCATGGGGT GATATCTTCG GTAGGGATTT GTTCCAACAA CATACTTAGT GTTAAAAAAT GAGTTGTCGG
TGTATGGGAT AGTTTGAAGT GAACACTATT ATTTGTGAGG ATGGGTAGTC ATGCACGGTG TATGGTGAAC TAACCACCCT
ACTGATTGAC TAGTTCCAGG GTTAGGCATA AATGCATTTC CTCTTTTGGG CGGTGGAAAT TGTATGTATG TAAGGATCAT
ATCTGATGAA GTTCgggggt gtttggttga tggctaagtt tgtcaaacca caacttaagc aagttgtggc ttgccacatg
gccacacttg aggcaaatag tatgaaaaca agccattgac atgtggggcc atgtgaatga agggggtgtg gctagccacg
attatggcag ttaactaaag acaTGCCTAA GGACCTATGT CATTGGTGCA AAATTCTGGC TTTTCATTCT TTTCGGAGGT
GGCATGTTGT CTTAGCATCT CTTGGCCAAG TTTATTGGAG ATGAGCATGG TTTTTCAATA AGAACTTGAA GTCCTCTTGA
AGCGACAGTA CTGTTTTGCT ATGCCCAGCA AACTTACTTT GGTGCTGCCT GCCATGAGTT TCCATTAGTC AGTGTTGAGC
TCAAACCCTT TTCACCTAGA TGATTTAAGA GTGGCGGCGA GCATCTCTTC TATTGGCCTA TTGTTGGTTC AAGCTCCCTT
CAGTTCTATG TGTTGCTTTA TTTGTCTCCT TGTTGTGCAT CTTTGTGCTT TTCTTAAAAA AAAAAAATCT TGTAAGACTC
ATGTTTGCTT CATTTATATT AATATACTCA CACACAAGGC TGTTGCTTGT TCCTTAAAAA GGAATATGTT TATCTCTTGC
ACTTATCTTC CTATGCTTTC CATCTGGAAT ATTGTAGGTT TGGGATATGT CATCTGGTGA GGACGGAAAT ATTGTTGGTG
GAGCCACCAT ATTTCTTTTC AACAACAAAA AGCAACTTAA AACAGGAAGG CAGAAGCTGC GACTATGGCC CCAAAAGGAG
GCAGATGGAA GAGTCCCCAC CACGACTCCT GGCAAGGTTG TAATATTGTA TGAAGAGCTC AATTTGCTTT TGGGTCAGGA
TGTGCTTCTT GACCTTTTAT Actatgtttt ctccttctta atgaaatgac acacaactct cctgcgttgt tctaaaaata
aTTTGCTTCT AATGCCCTTT TGATTCTGAT CTGCTCACTA ATCTCTCAAT CTAATGGTTA TTACATCTCT TCCGTACAGT
GAACTTACCC TCTTTTTGTT CCTATTACAC ATGTAGGTAC CTAAGAATGA GAGGGGTGAG ATAGAGCGTT TGGAGAGGCT
TGTTAATAAG CATGAAAGAG GACAGATACA ACATGTAGAA TGGTTGGATC GTCTTTTCTT CAGAGCCATG GACAAAGCTA
AGGAGAAGTG TGAAAGAACT GAAAATTTGT ACCCTAGCCT TGTTGTTGAA TTTTGCAGTT TTGAACACAG AGTTGTCTTC
CAGGTTATCT TTTCTTCGCC ACTGAGTTTA CATATGTCTT TCATCTCTCT TTTTCATTAT GAATTTGCCG TAATATTTTC
AAGTTCTCTT AGTATAAATA TATAATACTG TACATGTAGT GTGACATAAT GTTTACAATC TAGCATAGTC TATACTTTGG
AAGTTATATT GAGCGCATAA TCTATGAAAT ACACCATCAT AGTTAATATC TTTCTGAGTT GAAGCATGCT TTTTGCCATT
TGGTTGGTTC AGTGCAATCC ATTGTTTAAC TGAATAATAT TTTATTCTAG TTACTCTTTT CTTTTCTTTT TGTTGTTGGA
TAAATTGTCG ACATTTTGAT TTTTACCATA GTTTTTTCTT GTAATTGGTC ATGGATCATG GATGGATTAT CATTTTTTTT
TGTTAAGTGT AGAGTCATTT AATATTTACC GATTTATAAT ATGTTCATCT CTGCTATAGA AGTTTTTATC AAATTTTCCA
CATGCAGGAA TCTGGAGCAA ATTTCTATGC ACCAGCCCCT GTGTTGTTAT CAAATCAACT TGTTACTGTA TGGGACCCTG
AACTAGGAAG AACCAATCCA TCTGAGCACA AACAGTTAAA GCTTGCAAGG AGCCTAACTC GTGGAATAAT TGATAAAGAT
CTGAAACCAA GCTCAAATGA GCGAAAGTGA GTGCAAATTG TATTTTATTC TTTCCTCCTT GTCTTGTCAC CTTATAATGT
TTTTTAGCCT TTTATCTCTA TAACATGATG GTGAATCTTG GCATCGTGTA ATTTTTACAG TGGTTGCTCT AATCTCTTAA
ATTTTTCAAC ACAAAATTGT GAGGCAACCA ATTTGCATCC AGTTCCAGCT TCTTTAATTA GGAGTGACAG GAATAAAACT
TCAATTCTGA TTAGCACTAA TTTGAATTCA TGGATTTTTT TTTACCTAAA TCTAGTACTC TATGTCTAGG TGTCTGCAAA
GAATTATCAA GTTTCCTCCT ACACGCTCTT TACAAGTGGA TGAGAAGCAG CTGGTCTGGA AATTTCGGTT CTCTTTGATG
TCTGAGAAGA AAGCTCTTAC AAAGTTTGTT CGTGCAGTGG ACTGGAGCGA TATCCAAGTT AGTAAAAGCA TCCACACATC
TTATTGCCGT TTTTGCATTG TATTGCCATA TTTTTTATTA GGATCAGTGG ACTGGAGGAT GTCCCTTTGC ATGCCTGTGT
GTTCTTCACT TCTTTGGCTT GTTGGAACTG TTAGGAATAT GGCCTGTTTG ACGAAAATTG AGAGTTCACA GGGAATGGGA
GTTCAAATGA GAGTTTATGG TGAATTAGTC TTGAGTTTTT TTTTTTTTTT TGGTTTCCAC CTTGCCTGGT TAGTGAGATG
AGAAGTTACA GTGAATTAGT GTGGAGACTA TTTTAAGTCA TGATGAAGGG CTGGGATTTA TCCATCTTAA CATAAAGATG
GATTTCCATC CCAATTCCTG GCCCCTGCTA GGTATTAAAA TAGTGGAGTT AGCCCTCAAA TTCCCCACTG CCATCCTATC
TGAAGTTCTA AACTCCAATG CCAGTTATAC CCAACAGGTG TTTAGCAACA ATTgggaaga ggattgggac tttgaagtag
ggattcatga cagattagtc ttgagagttt gtttttttaa ttcttgatcc cttgtttggc aaagagtgta atcacaagga
attgctgaaa atactgtttt ttaagtgatg atgaagggct aggatttgcc tcatctctac ataagaaagc aattcgcacc
ccttccccat gtattaaaag tgtgggagtt agccccctca aactctgtcc ctatcccacc taaactccca ttcctggcaa
acaaacaaaa tgtttcataa cctccaccct ctaaagtccc atctcctcta aacaatttcc ctcatccaaa cAAGCTAACA
ACGAAATTAA TAACCCAACT CCCTCCCATT CCGTCGCAAT AATTTGCCTT ACCAAACAAG CTGTTAAGGC CAGGGAAAAT
GATACACGGA TGTTCATTGC AACTAGATTT TGTGATGTCG CAGTATCATT TCAAGTTTAT TTCTAAGAAA TTTCCTCATT
ATCTTTAGAT CTGTCAACTC CTCATTTTCT TGATCTAATG TCTATGTGGT TTGGTAGCTT CTTATAATTA GTATGTGATA
ATGCCATGCA GGAAGCTAAA CAAGCTGTTG AATTGATTAG AAAGTGGGAA ACAATTGATG TGGCTGATGC ATTAGAGCTT
CTCTCACCAG ACTTTGAAAG TGAGGAGGTG AGCTTTTTAT CTAACCTTTG TCTGTGGATG CTTCTTGTTT TCTTAGAAGA
GTACGTGCTA GGGTGGTTTT CATGTAGTTG GCATTGGCAC ATGGCACTGT GTGACTGGAA GGATATATTT ATCATTTCTG
TAACATATCC ATTTTTTGGC GCAAAGGTTC GAGCTTATGC CGTCAACATA CTTGAAAGGG CAGATGATGA AGAATTACAA
TGCTATTTAC TCCAGCTAGT GCAAGCTCTT CGGTTTGAAA GATCGGATGA GTCTTGTCTG GCACACTTTC TTGTAAAACG
TGGTATGTTC TCTTGTTTTT CTTTCTTTTT TTTTTTTTGA GGGGAGGTGT GTTCTCTTGT TATTGAAATC CATCTATGCC
TGTGTGAAAA TGACACGAGG AATCCATCTG TGGCATTTGG CAACCATGAA TTTGATGAAA TGTTCAGAAT ATGTAATATT
GGAAAAAAAA TGCACTTTCT TCACATGCAC AAATATAAGC AATTTTTAGC GTTTGAAATA TGCCAATAAA TATAAGCATT
TTTGGAGTAC CACTTTCCCA ATCCAATCAC CCCCCATGAT TTCCTGCTTT TATTGCTGCA TCGGTAGGCG TGATCTTTTC
CAAGCAGGTA AACTTTTTGG GGGCATCAAG GTAATTCTAC ACCAACCTTA CTCTATGCTA AAACTCCTAG AAATGCTTAT
ATTTGTGGAT GGATGGAGTA TTTAACATGC CTAAATATAG GCGAGATTGC CAGATGTTCA TTACTGTGCA ATAGTTATGG
ATGACCTAAC TCCCGGTGCA ACCCAAAATG CTTAATATTA ATTCTCAGAT ATGTCATACT ACTGTAGCTT CACCCCTGTC
AGACCTTTAA TTACTTAATA TTCTTTATGT CCTCACAAAG GCTATATGCG TTTATCATGA TGCTCTTTTT GTTAAACTGA
TATATAGAAA ACTAACACAA ATTTTATGGT CTTTTATCCA TTCAGCTGTA TCAAACATTG AAATTGCTAG CTTCCTTCGC
TGGTATGTGG TCGTTGAGCT GCGTGACACT GCATATGCAA GACGGTATTA CAGTACATAT GACTTGCTTG AAAATGGCAT
GATGAAAGTG CGTTTTTCTT CCATTTTGGA TACATCTCTT GATTCTGCCC TTACTAATAT TACATGCAAT TATATTTATG
GATGTTTCTG CTCAGTTTGC TAGGGATGAT GGTGATGAAG ACGGATTTCG ACTTTGGCAG AGTTTAACAC GGCAGACTGA
ACTTATGGCT CAGTTAGGTT CTATTATGAA GGATGTAAAA CAAGTTCGTG GTAGTGCACA AAAGAAAATC GATGGATTAA
GACAATTATT ATCAGGAGTT TTCAGTGAGC TTACCAACTT TGATGAGGTG CAACTTATTT CATCATTAAT GTGTTGTCTG
TCTCCTGTTT TTCAGTGCTA GAGAAACATA TCATAGTTCA GATTAACTTG TGTGGTTGCT TGAACTGATG AGTTCCGTTT
TATTAATTTC AGCCAATTCG TTCACCATTA GCACCAACTG TTCTCCTTAC TGGGGTTATA CCTCAAGAAT CATCTATATT
TAAAAGTGCC TTGCATCCTT TGCGCCTTGC CTTTAAGACC GCAAATGGGG GAATATCGAA GATAATTTAT AAAAAGGGAG
ATGATCTCCG CCAAGATCAG CTGGTAATTT TCAATGTGCC TTTATATTTA TTTCCAAGTT TTTCTTTTTC TTTTTGTTCT
AGTCTGTATG CCAATGGGTC ACCCTCTTTA TGTAAGGGTA ACGTGGTTTG GCTTTCTGAG CAAGTGATTA CGTTATAAAT
ATTTCTGAAA TTATTGAAAA ACATGTATTC AACTGACAAT GCTATGCTCT AAATCAGAGC TGCTTGAGCT GGATATTTGG
TTGCTTGGTA ACAGCTGGTT GGTCCACTGT ACTGTCTGAT CTATTATGTG CTGGTCTTTG TTGTGTTGAG AATAGTGTTT
ACAATTCCCG AAAGAACACA TCACAAGCTG CTTCATGGTG TTATGTAGGA GTAGATTTTA GTTCTTAGAG CCTTCTTCTC
GTGGTTTTGA ACTTTTAATT CATGTATATA TACTATGTCT AGCAGTTTTT AGAGCCTTCG TCTTGTGGTT TTAAACTTTT
AATTCTGGCT GTGTTTGGCA GCCTGTTGCT GTGGCTGCGA CGCACCTATA CATACAGCGT ATGTATTGTA CAGCGGCTGC
GGCTGCAGCC ACAGCAATGC CCACCGAACA GGCATATTTA GCATATACTA TGCATAAACT AGATGATGCC CCATGCGTTA
CTGGTAGGAA ACCATCAGGA TGGACAGCAT TGAGAAGAGA CTATGCAGTT ATATATTTTG TTAGACAAAT TTAGTAAAGC
ACGCAGTGAA AAATAAAAAT ATTTTTAAAA AAGTAGATTT GAGAGTAAAG AAAATAACGT TCATTGAGGC ACAACAATAC
TGATGATAAG GATGGGGAAC CTTTTACCAC TGCTTTTGTC AGACCGTTCA TAATGGAAAA TAAGGAGACA CATAGGAACC
ATCCTTAGAG TCCGGAAATG AAACTGAAGT CTATTATTCT CCTGCAAATT GAAATGCTGA GAAGATTTTT AAAAAAAACT
TGACCTTGAT CATGCTTCCT TCCACATGAA AAGCTCATTC TAGACTTCTC AGTGCTATTT CACGGACCCG CATACTAGGA
ACAGAAAACA CTGAAACAGT CATTTTATTT TACTTGATAT GGCTGAATAC TTAAAAGAGA TGAAAGATAT ATTTTCTAAC
CATCTGAAAT GATAGTTGTT GCGATCCAAA TCAACTATAT GAAACTTCTT CCTGTAACAG GGGATGAAAA AAAGGCAAGG
GACCTGTAGG TATTTAGGAT ATGTATGCAA GTTAAGAGAA GTAAACCAAA TAGTTAAAAT GGCGAAGATG TAAGAATAAA
TATAATTCAA ATGTATTGTC TACCTCTGCA ACTCATATTC AGACGCTTGT GTGGGAGTGA ATTGTGATTA ATTATTTCTT
TGTTCTTTAT AGGTTATTCA AATGGTCTCC TTGATGGACC GGCTGCTCAA ATTAGAAAAT ATGGATTTAC ACCTTACTCC
ATATCGAGTT CTTGCAACTC AACCAGATGA AGGAATGCTT GAATTTATTC CTTCCAGTTC ACTTGCACAG GTAACTCGGT
ATTGATTAAT GATTATCACG ACGGCCACTG TTGAATTGCC AGAAGTTGTC TTTTCCATTC GGGTGAAATT ATATGCAAAT
TGTAGCTTCA TTTCATGATT ATCTTTGTTG ATTCAAGTAA TTGTTTCTTC TCAGATTCTA TCAGAACATC GCACTATTAC
AAGTTACCTA CAAAAATTTC ATCCTGATGA AGATGGTCCT TTTGGTATAA CTGCTCAGTG CTTGGAAACT TTCATAAAAA
GCTGTGCTGG TTACTCTGTC ATTACATATA TAATGGGGGT TGGAGACAGG TTCGCATTTT TATTTCTCAA AATCTCAGAC
CCTTGGTGCC TTTGGTTCTG ACTATCACTT ATGAGTACTT ATAGGCTAGT TAACCTTATT AAAACTTCAT TCACGAAGGT
GATAAGAGAG AAACATATTA CATTCAGCAG CCTTTAGCTG TCAATCATAC ATTGCTGTGC ATCGCATGCT ACTTAATGTG
CCTTTGAATA ACTTGTCTGT ATCCCAGTTC ATGTTTTTTT TACATGATTC ATAATCAGCC ATGAAAATGG TTGAGAGTTG
TGTTTGTTTT TACCAAGGAT ATAATCATAT ATGCAGGCCC AACTTGGACT TTCTGGTTTG TTGACAATAT TAGGCATATC
ATTCTACATT ATGCGGGTCA AAGTTTGCTA GTGTTCCCCA TACTTTAACT GAACTCTATC CATGGTCACA GCATATTTTG
TAGTAATGTC CATATGTCCA GTTTGTCAAG AGAGGACCTG GCTGAATGCT GATGTTACAG TTTTTTCTGC CATCTGGATA
TATGTAGCTA GTTAGCTACT AGTGTGCTAA GAACCATGAT ATGATGTTTC ACAATAGGAA TGACAAATGT TCTTTTTCCT
CCCATTCTAG GCATCTGGAT AATCTTCTTC TAACAGATGA TGGACGCCTC TTCCACGTTG ATTTCGCTTT CATTCTGGGT
AAAGATCCAA AGCCATTTCC ACCACCAATG AAACTATGCA AAGAAATGGT TGAGGCCATG GGTGGTGCAG AAAGGTAAAC
TCTTTAACTA ACTTGGCGGG ATATCTGCAT GATTTGTTCC TCTGCTAAAA GCCGATTGCT CGTTTTCAGC CAATACTACA
CGAGATTCAA GTCATACTGT TGCGAAGCAT ACAACATTTT AAGGAAGTCC AGTAGCCTCA TATTGAATCT GTTCAACTTG
ATGAGAAGAT CAAATATTCC AGACATCACT AACGAGGAAA ATGCAGGCCT TAAGGTACTT AAGCCGTTTT CACGACTTGA
GCCCATGAGT TTTTATAAAG ATCATAGCAA TCGAAATGAC CATATTTTCA TTATCATGAG TTGAGCCCCA TGATTAAAGA
ACATAGCACT CTAAAACTGA CCATATTTTT CTATGTTGAG AGCAGCTTCA AGAGAAATTT CGGCTTGATC TGGAAGATGA
GGAAGCCATA CATTTCTTCC AAGATCTTAT CAACGAAAGC GTCAGCGCTT TGTTCCCTCA GATGGTTGAG ACAATCCATA
GATGGGCTCA ATACTGGCGC TAAGCAAAGT CGGTAACAGG CATGATTGAT GTATATACGT ACTAACATGC TCGCCTGCGA
CCGATTTATT TGCAGCAGGT TGCAGGTCTG AACTCTGAAT CCATTTACAT TTGTCGATAG CTTAGTTTGT GAATATACCA
CGCATGCGCC TGGTTAGAAA GCTATTGAAT GTAGACAGAA GTGTAATAAG GCTAGCAGTA TTAAAAAAAG AATCTTTAGC
GGCAAATATA ATAATGTTTT ATGTGCCTCA ACCCTGACAA TTTTATGCTT CTTTTTGTAA GTTTGGAGAA TTCGAACGTA
GAAAATAAAA TAAACTATTT ATT

Locus: Os05g0180600

Loading...

Locus: Os05g0180600

Loading...