Os05t0182500-01

Locus

Os05g0182500

Description

Similar to Ubiquitin carrier protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

UBC8

CGSNL Gene Name

UBIQUITIN-CONJUGATING ENZYME 8

Oryzabase Gene Symbol Synonym(s)

OsUBC8

Oryzabase Gene Name Synonym(s)

Ubiquitin-conjugating enzyme 8

Transcript Evidence

AK111549 (DDBJ, Best hit)

Protein Evidence

B8AYY8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: acid-amino acid ligase activity (GO:0016881)

Functional domain (InterPro)

Ubiquitin-conjugating enzyme, E2 (IPR000608)

Ubiquitin-conjugating enzyme/RWD-like (IPR016135)

Full-length cDNA

J013057C14 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0182500-01)

RiceXPro (AK111549)

Others

Oryzabase (19556)

KEGG (Os05t0182500-01 (EC:6.3.2.19))

Transcript

2918 bp

>Os05t0182500-01 Similar to Ubiquitin carrier protein.
GTCGCGTCGTCCCCAAATCCGCTACTCGCTATCCTCCTTCCTCCATGATTCCCTTCTCGA
ATCTTCTCACTTTCTTCTGAAGTGCTCCGCTCCGCTCCGCTCCGATCCAATCCACTCCGC
CCGAGTCCCCCACCCATCGGCACCCACCAGCGCGAGGGTGGGTGGCCATCGATCGATCGG
CCCATCGCCGATTCCCGCGGGATCTGCGGCGGCGCGGGGGGATTTGATCGGAGGGTGAAT
ATGTCGACGCCAGCAAGGAAGAGGTTGATGAGGGATTTCAAACGACTGATGCAGGATCCT
CCAGCTGGCATAAGTGGGGCCCCACAGGACAACAATATAATGCTTTGGAATGCTGTAATT
TTTGGCCCTGATGATACTCCTTGGGATGGAGGTACGTTCAAGCTGACACTTCAGTTTACT
GAAGATTATCCTAACAAGCCACCTACAGTGCGATTTGTTTCTCGGATGTTTCATCCTAAC
AGTAAGCCTCTCTCCCTGCTGTTTAATACTTGCCTGTGGCATGGTTCCTGTTTCTTACAA
GTTATAAGTATTTATGTGGCATTTCGGAACAATAGTCTAACATCCCGAGAGACGTACAAT
TAAGAACCAGGCTAAAATAAGATATGAGAACTAGTGAGACAATTGAGCTGAATCTGGATG
GCTCATGTCAAGGCCAAATGCTACAGGAAACCTATGACAGTTCCACCTCCACCTTCTAGT
GACGTTGGCAGTCCTTTATTCTACATCGTTGAAAAGCTGACCTAGGTAATTTCTAAATGT
ATCAAACAAGAATCAGCCAAAAAATAGGATCCAGAACTAGCGATCTTATTCATGGATTGG
ATCTAGATGCAGCATAGAAGGCCACCCTGATTCTCCTTGCTTCCATGCCATCCAAAATTA
TTTTGGTCACTGAGATCAATGTTCTAGTTATCCCATTTTAGTTTCTTTTTCTATCTAATG
CAGAAGTTGGTTGTTAAGGCGGTAAGGCATCCTAAGGCGACCCCGGACTGCCTTATCGCC
ATAGCGGTAAGGCGTAAGGCGAGGCGACGCCTTAGGCACTCCATACCAATTAGATGACAA
ACAAAATAATCTAATATGATAGCAAATCAAAGCTTGGCAACTCTTGAGCCCACTAGATGG
TTGTAATAATTACTTAACCAGATATCAATTTATTAACTAAAAGAACACCATCCTATAAAT
ACAGAGTGAGGGTGCATGGGGGAAGAGCAAACGGGGTAAATATGTGCTAAGTACTAACTA
CTAACAGGGAGTCAGGGATGTAAGCGAGGGGCAGGGAGTAAAACAGAGCAGTAGAGGGAG
GATTATAGTAGATGAGATGTAGAGGAGAGGGAGGAAAACCACAACATAGCAGCAAATGAG
GGAGCAGAGTAGAGGATGTAGAAGAGGGGGGAGGAAACACCAAAACAAGCAGCAGAGGAA
GGATAAGAACAGGGTAGAGGAAGGAGCAAAGCAGGATCATGTAGAGCAGAGAAAGAAACA
GAGGAAAGAAGAGGGTGGAGGAAAGAGGAGAAAGAAGAGCGTGCCTGCTTAGTTTTTGTG
TCAATGGTGAGGACCAGGATGATGGCGCAGGTGCAGAGGACCAGGACGATGGCGCAGGTG
CAGAGGACCAGGACAATGGTGCAGGCACAGGATAGCCGCAGGCAACAACTTGGATCGCCG
CCAGGGATGGAGATGTCGCGAGGGATGGATCGCCACAGCCTCAGACTCCAGCGACCCTCT
TTCTGTTGTTTTCTCCTTGATTTGGTGGGATATGGTGCGTGGGGACCTTTTCACCCCAAA
AATTGGCGCTTCTGTTAGTTCTGTTTCACGCCCAGGGCCCATGGCGCCAATTTTTTCGGG
CTCTTCAACCAATCGCGGCAAAAACCACGCCCTCGACTTCCTGTGGCGTTGCCTTTAGCC
ATTGTAGCGCCTAAGGACGCAATATCGACGCCGTAGCGGCGCCTTGGGCATAAGGCGGAC
GCCATAAGCAATATGGTAAGGCGGGCCAGACGCCCTGACTCCTGGCAGCGCCTTACCGCT
ATAGCGACGCTATGGCGATGCCTTGACAACCAGCAGAACATTGAATAAGGTATCAAATAT
CCAATTGTTGCAATTATGCTGTTATGGGCCTCATCGCAGGCAGTTAAGAGTATACTAGCA
AATACGCAGATCCAATTAGTACTTGTTTGATTTGATGACTAGCTTTGCTCTCGAATGTCA
TAATTGATGACTAGTATAAGTTTACTTGCATCAAGATATAAAGGACTTTACAGATATGCA
GTATATCTGAAGCTTATTTAATGCTTCATACAATTTATGTAAATACTTAAAAAGATCGAC
TTCTTTTGCTACTTGTGTGGAAGCACTTATGTACCTTAGAATAGCATGATATTGTTGTAT
CTCCATTTGTTTTACTTTCCTAACATTTTCCTTTTATCATGTACAGTTTATGCTGATGGG
AGCATATGCTTAGATATACTACAAAACCAGTGGAGCCCCATATATGATGTAGCTGCTATA
CTCACATCCATCCAGTCGCTGCTTTGCGATCCAAACCCAAATTCACCTGCCAACTCTGAA
GCTGCCCGCCTATTCAGTGAGAACAAGCGGGAATACAACCGAAAAGTTCGTGAGATAGTG
GAGCAGAGCTGGACCGCGGACTGATCCACTCCATCTAACCATATGATGCCTGATACTTAA
AACGCTCATCTTTTCAGTGTGTCGTGTACCAAACTGCTTGTAATTAAAATGCTAAAACAG
TAAAACGTGCTTACTGTTATGTATGCCCTTCCCGAATACGAGGAAGGCTTTGGACCATGT
TGAGGACCATATGGACTTCTTATATAACATCTATTGTTGCCAGCTACTAAGTGTTAAATG
CTATATTGAGTACGAAGCCGTGCCTAAAATTCAATGAG

CDS

363 bp

>Os05t0182500-01 Similar to Ubiquitin carrier protein.
ATGTCGACGCCAGCAAGGAAGAGGTTGATGAGGGATTTCAAACGACTGATGCAGGATCCT
CCAGCTGGCATAAGTGGGGCCCCACAGGACAACAATATAATGCTTTGGAATGCTGTAATT
TTTGGCCCTGATGATACTCCTTGGGATGGAGGTACGTTCAAGCTGACACTTCAGTTTACT
GAAGATTATCCTAACAAGCCACCTACAGTGCGATTTGTTTCTCGGATGTTTCATCCTAAC
AGTAAGCCTCTCTCCCTGCTGTTTAATACTTGCCTGTGGCATGGTTCCTGTTTCTTACAA
GTTATAAGTATTTATGTGGCATTTCGGAACAATAGTCTAACATCCCGAGAGACGTACAAT
TAA

Protein

121 aa

>Os05t0182500-01 Similar to Ubiquitin carrier protein.
MSTPARKRLMRDFKRLMQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFT
EDYPNKPPTVRFVSRMFHPNSKPLSLLFNTCLWHGSCFLQVISIYVAFRNNSLTSRETYN
*

5'UTR

chr05:4958322..4958554 (+ strand) : 233 bp

chr05:4959373..4959379 (+ strand) : 7 bp

CDS

chr05:4959380..4959504 (+ strand) : 125 bp

chr05:4959596..4959621 (+ strand) : 26 bp

chr05:4961608..4961819 (+ strand) : 212 bp

3'UTR

chr05:4961820..4963751 (+ strand) : 1932 bp

chr05:4964550..4964932 (+ strand) : 383 bp

FASTA

>Os05t0182500-01 class=Sequence position=chr05:4958322..4964932 (+ strand)
GTCGCGTCGT CCCCAAATCC GCTACTCGCT ATCCTCCTTC CTCCATGATT CCCTTCTCGA ATCTTCTCAC TTTCTTCTGA
AGTGCTCCGC TCCGCTCCGC TCCGATCCAA TCCACTCCGC CCGAGTCCCC CACCCATCGG CACCCACCAG CGCGAGGGTG
GGTGGCCATC GATCGATCGG CCCATCGCCG ATTCCCGCGG GATCTGCGGC GGCGCGGGGG GATTTGATCG GAGGTGAGAA
CCATTCGCCG TCCTGGTTGT GTATGGTTCC TCGCGATTGT TCCCTCGCAG ACCGTGAAAT TGGTCGTCGT CCGTGGAGGA
TCTGTGCGCA TATGACCGTT TGTGTCTAGT TGAATTCACA GTTTGTGGTG ATTTGTTTCG GTGATGAGGA TTTGGGGGTG
GTGGTAGGCT TTATTTCATG TTTGTTGGGG GTGATTGGTT GGGGGGAGGA TGAGGGTTGC GGAGGGTATG GGCGATTGAT
TGGTGGAGTT GTTGCGCTTG TCTTCGTTGG GGGAAATTTA TGGGTCCAGA TTTGCAGTAG TATAATGGCC TTGTTGGGTT
CATCGGATGA CCTCGGTCTG TTAATCTAAG CATGGGAAAT AGGGATGGAA TGGTGTGCTT GTCATGTTTA TGTTTCGCCT
TTTCGTTTCA TGGAGATTTT TTCTCGTGAT CACAGGATGT ATGGGTTGTT TGGAAGGGAA TTCCTGTACC TATTTGTGCT
CAGAGCCTCA GATGCAACTC TTGTGCATGT GGGATTCTCC AAGACTCCAG TTACTGGCTG TCCAAACTTA GTCGAGAACA
GGACAAACGG AAAATATGAA AATTCTCATA TGTTACTTTT GCAACATCCA TAAAAAAATT GTATACCCAA AGCAATTTTT
TCTTCTGAAA TTACAGGCTA CTTCAACACT ATTACTAGCA TAGTGATGAA CTGCCTTGAT TGTTAGTATG GATTGGTCTG
GCTAGTAGGT GTCATGGGTA AACTAAAGAA TCTCAGTGTA GGTTTCCCAT TCCTTCTATT TAGCTTATTT GGTGACTTGG
TATCTACACA GGGTGAATAT GTCGACGCCA GCAAGGAAGA GGTTGATGAG GGATTTCAAA CGACTGATGC AGGATCCTCC
AGCTGGCATA AGTGGGGCCC CACAGGACAA CAATATAATG CTTTGGAATG CTGTAATTTT TGGGTAAGGT GTTAGACTTA
AGAGATATGT TTTATTCCTT TCGGTTTTAT TTTGATCCAT TATACTTAGT TGTCAATTAT GTCTTGTTTT GCAGCCCTGA
TGATACTCCT TGGGATGGAG GTAAGGAATT TAAAGTCTTT CCTTTTATTT GGGGTTTGCA TTTGGGACTT GGGAGAGTAA
TCACAGGCAT GATATgggga aatttaacta ttttccactt ttagttttgg caattaacca aatacccttc ttagatttgc
acttaagaat ttgccactgg agagagaagc ttttgtaatt ttttgccact ttctgcACTG TTCAGTGCCA CATATACATG
CCAGCATGGA CCAGGCACAC GAAATGACTA ATCTACCCTT GTTAGTAATG TCTGTAATAT AAGCTGAGTC AGGAATAATA
TTTGGACAAA TTGCTTTCGC GAATCAGTTG CATCGGTATG GATGCTGTTC ACTTTTATGA GGTACTATAT TAAAGACCGA
GTACCTCCAC ATCAGTTAAC AAATCAATAT TTGAAGGAAT AGATCCACTG AGATGGTTAT AACAAACTTT CAAAACGATA
CTTAGATtga gttcttttgt tcactttcac aacttatctc tctcgttttt catgtgtacg tttttcaagc tgctaaacgg
tATTCCAATT TGGCTGGTAT TGTTGGGATG GTGCCACCTG GAGTGAGCTC GATTAAGGTG TACGATAGCA Tggtttggaa
atatttctct cttcacgtaa aactgagcaa agaattagcg catgactaat ttagtttgag ttttaagaaa taaagaatag
attaatatat atttttaaag taacttaatt ttatttaaaa agttattaaa gaaacGTGCG AAAAAAAATG AGGGAGTAGA
ACTCAgactg gcggaggccc tggttccggt ttttttcagt ccaaccgccg gtccggtcgg tcctaataac tgtgagtagA
AGTTAGAAAA AAGACATCCG AATGCAGCCT CAGAAAGTTA ATGAACTGAC TGTAACATGA ATGGTGCCAT TGATGTTGTT
GCCTTATAAA TTTAAAAGGG TAAAATGGGA AGATTGGGCA GGTTGCTGGT TTCTCTTGGT ATCTTTCCAG TGAATGAATT
ATGACTAAGA TTCAATGCGG ACAGGCTTAG CAACTGAGAA ACTTACCACT AGCTAGAAGG GGTAGGTTGG TCATTTTTCA
cgttggtcca tgttggcatg cacatgtggc actccacagg gcaaaaagtg gcaaaaagtt acaaaagctt ctctctctaa
tggcaaattc ttaagtacaa tcttaagaag ggtatttggt taattgtcaa atgtaaaagt ggcaaatagt taaattcccc
CATGATATGA CGCATATCTT GTACTTCATT TTACTTCTGT TTTCATATTC AGAGATAGTT TTGCTTGCAT AATTCCATTT
TTGTTGTTGA TATAACAATT GGTTCATTTA ATTAATAGGC ACTTAACTTT CTGGACAAAT GATACAATTT ATAATTATCA
AACAAATAGA ATGTATGAAC CTCATTTTTT CTGTCAGTTC AACCCACATT TCTACTGTCT TTGGGATTTT ATGTCTCGGA
ATGTATATTC TACACTTTAG ACACTTTTCT TTTTGTCTAC AATGGTCCAG CCTTGGAGCA TGTAGTTCAA ACATTTTAGG
TTAATTTTAA TTAAAACTTG TAATTTTCTT GTCTAATCGA GTGAAGCATG TGTTTTTTTT GGGGTGACAT GGTTTGGAGA
TCTTATTTTG ATTAATGTTT TGAATTCAAA TATATGATAG TCTAAATCGT CAATAAACAT TTGTTAAAAC CTTTTCATCA
TTAGCTGATC ATGTTTTATT GGTTCTATGA CTGAGAAAGT GCTTGTTTTT TTTAAAGAGC CTCTGTACAA CATAAATAAG
GTGATTAACC CGTTTTAAAC AGTCTGTTGG GGAAGTCCTC TTTGCCAAAC GTCCATTTGA TATTTTTCCT TTTTGTATTT
ATTGGCATTT TGTTCTTGTA CGTGTCACCA ATTGTACTCT TTTACATGTT AACACTGTCA AATTATGTTT ACTTCGCCAT
CGCCAGGTAC GTTCAAGCTG ACACTTCAGT TTACTGAAGA TTATCCTAAC AAGCCACCTA CAGTGCGATT TGTTTCTCGG
ATGTTTCATC CTAACAGTAA GCCTCTCTCC CTGCTGTTTA ATACTTGCCT GTGGCATGGT TCCTGTTTCT TACAAGTTAT
AAGTATTTAT GTGGCATTTC GGAACAATAG TCTAACATCC CGAGAGACGT ACAATTAAGA ACCAGGCTAA AATAAGATAT
GAGAACTAGT GAGACAATTG AGCTGAATCT GGATGGCTCA TGTCAAGGCC AAATGCTACA GGAAACCTAT GACAGTTCCA
CCTCCACCTT CTAGTGACGT TGGCAGTCCT TTATTCTACA TCGTTGAAAA GCTGACCTAG GTAATTTCTA AATGTATCAA
ACAAGAATCA GCCAAAAAAT AGGATCCAGA ACTAGCGATC TTATTCATGG ATTGGATCTA GATGCAGCAT AGAAGGCCAC
CCTGATTCTC CTTGCTTCCA TGCCATCCAA AATTATTTTG GTCACTGAGA TCAATGTTCT AGTTATCCCA TTTTAGTTTC
TTTTTCTATC TAATGCAGAA GTTGGTTGTT AAGGCGGTAA GGCATCCTAA GGCGACCCCG GACTGCCTTA TCGCCATAGC
GGTAAGGCGT AAGGCGAGGC GACGCCTTAG GCACTCCATA CCAATTAGAT GACAAACAAA ATAATCTAAT ATGATAGCAA
ATCAAAGCTT GGCAACTCTT GAGCCCACTA GATGGTTGTA ATAATTACTT AACCAGATAT CAATTTATTA ACTAAAAGAA
CACCATCCTA TAAATACAGA GTGAGGGTGC ATGGGGGAAG AGCAAACGGG GTAAATATGT GCTAAGTACT AACTACTAAC
AGGGAGTCAG GGATGTAAGC GAGGGGCAGG GAGTAAAACA GAGCAGTAGA GGGAGGATTA TAGTAGATGA GATGTAGAGG
AGAGGGAGGA AAACCACAAC ATAGCAGCAA ATGAGGGAGC AGAGTAGAGG ATGTAGAAGA GGGGGGAGGA AACACCAAAA
CAAGCAGCAG AGGAAGGATA AGAACAGGGT AGAGGAAGGA GCAAAGCAGG ATCATGTAGA GCAGAGAAAG AAACAGAGGA
AAGAAGAGGG TGGAGGAAAG AGGAGAAAGA AGAGCGTGCC TGCTTAGTTT TTGTGTCAAT GGTGAGGACC AGGATGATGG
CGCAGGTGCA GAGGACCAGG ACGATGGCGC AGGTGCAGAG GACCAGGACA ATGGTGCAGG CACAGGATAG CCGCAGGCAA
CAACTTGGAT CGCCGCCAGG GATGGAGATG TCGCGAGGGA TGGATCGCCA CAGCCTCAGA CTCCAGCGAC CCTCTTTCTG
TTGTTTTCTC CTTGATTTGG TGGGATATGG TGCGTGGGGA CCTTTTCACC CCAAAAATTG GCGCTTCTGT TAGTTCTGTT
TCACGCCCAG GGCCCATGGC GCCAATTTTT TCGGGCTCTT CAACCAATCG CGGCAAAAAC CACGCCCTCG ACTTCCTGTG
GCGTTGCCTT TAGCCATTGT AGCGCCTAAG GACGCAATAT CGACGCCGTA GCGGCGCCTT GGGCATAAGG CGGACGCCAT
AAGCAATATG GTAAGGCGGG CCAGACGCCC TGACTCCTGG CAGCGCCTTA CCGCTATAGC GACGCTATGG CGATGCCTTG
ACAACCAGCA GAACATTGAA TAAGGTATCA AATATCCAAT TGTTGCAATT ATGCTGTTAT GGGCCTCATC GCAGGCAGTT
AAGAGTATAC TAGCAAATAC GCAGATCCAA TTAGTACTTG TTTGATTTGA TGACTAGCTT TGCTCTCGAA TGTCATAATT
GATGACTAGT ATAAGTTTAC TTGCATCAAG ATATAAAGGA CTTTACAGAT ATGCAGTATA TCTGAAGCTT ATTTAATGCT
TCATACAATT TATGTAAATA CTTAAAAAGA TCGACTTCTT TTGCTACTTG TGTGGAAGCA CTTATGTACC TTAGAATAGC
ATGATATTGT TGTATCTCCA TTTGTTTTAC TTTCCTAACA TTTTCCTTTT ATCATGTACA GTTTATGCTG ATGGGAGCAT
ATGCTTAGAT ATACTACAAA ACCAGTGGAG CCCCATATAT GATGTAGCTG CTATACTCAC ATCCATCCAG GTAGATGATG
CCTTTTTTGG GGGTATTAGC ATGTCATGAT GTCCTGTCAT GTTTGTTGCA ATATTTTGTA TCATGTTTAT AATTCGTGCT
TCTGATTTTG GTCCTGTCTT TAAAAATATT GAGCAAACTC ACCAATCTAG TATAAGTGAA TTGTCACTAA CTTAATTGTT
GTCGCCTTAA AATACACATG GTGTTTCCTT ATAGATAGTC TGCTTTTCCT CCCCACATGC TCCATTGTTA AGTAGTAAGC
TATATTCACT TGAATAATTA TTTTTCTTTG TTAGAGGCAC TATCACGCGA TATACCTGTG GAAGGGTTTC ATCTTGAGAG
TAGAGATATT AGGCCTCTGT GACTGATTAT CACTATTCAG TATTAAGTGA CATTGGCACG TGGGGTATAT ATACATAAAA
AAGAATAATA TTTCCAGCCT CTGCTTAGTT TTTGATTCTG GTGACAACTA TATATAGGCC ACGAAGAGTA GACGGCTAAC
TTCTATATGT AGGCAAACTT CTATAACAGT AACTTTAGTG TGGTGAGGCC GCCTGTCAAT AACAACATAT TATCTTTATA
TGTTTTTCAT ATACATGGTG ATATTTATTA ATCTATGCTC TATGGAAAAT AGTATAGAAC ACAATAATTT TTATATCAGT
TGGGATACTT GCATATCTTG CTTCTGTGAA TAACAAATGC ATATCACAAC AATGCATATT TCATGGACTC AAGACATTGA
CATATTACAG GCAATTTCAT TGATTTAACT GTTCAGTACT TCTATTTCCT GCTTTGTATT ATTTCCAGTC GCTGCTTTGC
GATCCAAACC CAAATTCACC TGCCAACTCT GAAGCTGCCC GCCTATTCAG TGAGAACAAG CGGGAATACA ACCGAAAAGT
TCGTGAGATA GTGGAGCAGA GCTGGACCGC GGACTGATCC ACTCCATCTA ACCATATGAT GCCTGATACT TAAAACGCTC
ATCTTTTCAG TGTGTCGTGT ACCAAACTGC TTGTAATTAA AATGCTAAAA CAGTAAAACG TGCTTACTGT TATGTATGCC
CTTCCCGAAT ACGAGGAAGG CTTTGGACCA TGTTGAGGAC CATATGGACT TCTTATATAA CATCTATTGT TGCCAGCTAC
TAAGTGTTAA ATGCTATATT GAGTACGAAG CCGTGCCTAA AATTCAATGA G

Locus: Os05g0182500

Loading...

Locus: Os05g0182500

Loading...