Os05t0182500-02

Locus

Os05g0182500

Description

Rad6 (Ubiquitin carrier protein).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

UBC8

CGSNL Gene Name

UBIQUITIN-CONJUGATING ENZYME 8

Oryzabase Gene Symbol Synonym(s)

OsUBC8

Oryzabase Gene Name Synonym(s)

Ubiquitin-conjugating enzyme 8

Transcript Evidence

AK112003 (DDBJ, Best hit)

Protein Evidence

B8AYY8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: acid-amino acid ligase activity (GO:0016881)

Functional domain (InterPro)

Ubiquitin-conjugating enzyme, E2 (IPR000608)

Ubiquitin-conjugating enzyme/RWD-like (IPR016135)

Ubiquitin-conjugating enzyme, active site (IPR023313)

Full-length cDNA

001-035-F01 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0182500-02)

RiceXPro (AK112003)

Others

Oryzabase (19556)

KEGG (Os05t0182500-02 (EC:6.3.2.19))

Transcript

946 bp

>Os05t0182500-02 Rad6 (Ubiquitin carrier protein).
CTACTCGCTATCCTCCTTCCTCCATGATTCCCTTCTCGAATCTTCTCACTTTCTTCTGAA
GTGCTCCGCTCCGCTCCGCTCCGATCCAATCCACTCCGCCCGAGTCCCCCACCCATCGGC
ACCCACCAGCGCGAGGGTGGGTGGCCATCGATCGATCGGCCCATCGCCGATTCCCGCGGG
ATCTGCGGCGGCGCGGGGGGATTTGATCGGAGGGTGAATATGTCGACGCCAGCAAGGAAG
AGGTTGATGAGGGATTTCAAACGACTGATGCAGGATCCTCCAGCTGGCATAAGTGGGGCC
CCACAGGACAACAATATAATGCTTTGGAATGCTGTAATTTTTGGCCCTGATGATACTCCT
TGGGATGGAGGTACGTTCAAGCTGACACTTCAGTTTACTGAAGATTATCCTAACAAGCCA
CCTACAGTGCGATTTGTTTCTCGGATGTTTCATCCTAACATTTATGCTGATGGGAGCATA
TGCTTAGATATACTACAAAACCAGTGGAGCCCCATATATGATGTAGCTGCTATACTCACA
TCCATCCAGTCGCTGCTTTGCGATCCAAACCCAAATTCACCTGCCAACTCTGAAGCTGCC
CGCCTATTCAGTGAGAACAAGCGGGAATACAACCGAAAAGTTCGTGAGATAGTGGAGCAG
AGCTGGACCGCGGACTGATCCACTCCATCTAACCATATGATGCCTGATACTTAAAACGCT
CATCTTTTCAGTGTGTCGTGTACCAAACTGCTTGTAATTAAAATGCTAAAACAGTAAAAC
GTGCTTACTGTTATGTATGCCCTTCCCGAATACGAGGAAGGCTTTGGACCATGTTGAGGA
CCATATGGACTTCTTATATAACATCTATTGTTGCCAGCTACTAAGTGTTAAATGCTATAT
TGAGTACGAAGCCGTGCCTAAAATTCAATGAGTAATTCTTTTCGCC

CDS

459 bp

>Os05t0182500-02 Rad6 (Ubiquitin carrier protein).
ATGTCGACGCCAGCAAGGAAGAGGTTGATGAGGGATTTCAAACGACTGATGCAGGATCCT
CCAGCTGGCATAAGTGGGGCCCCACAGGACAACAATATAATGCTTTGGAATGCTGTAATT
TTTGGCCCTGATGATACTCCTTGGGATGGAGGTACGTTCAAGCTGACACTTCAGTTTACT
GAAGATTATCCTAACAAGCCACCTACAGTGCGATTTGTTTCTCGGATGTTTCATCCTAAC
ATTTATGCTGATGGGAGCATATGCTTAGATATACTACAAAACCAGTGGAGCCCCATATAT
GATGTAGCTGCTATACTCACATCCATCCAGTCGCTGCTTTGCGATCCAAACCCAAATTCA
CCTGCCAACTCTGAAGCTGCCCGCCTATTCAGTGAGAACAAGCGGGAATACAACCGAAAA
GTTCGTGAGATAGTGGAGCAGAGCTGGACCGCGGACTGA

Protein

153 aa

>Os05t0182500-02 Rad6 (Ubiquitin carrier protein).
MSTPARKRLMRDFKRLMQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFT
EDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNS
PANSEAARLFSENKREYNRKVREIVEQSWTAD*

5'UTR

chr05:4958343..4958554 (+ strand) : 212 bp

chr05:4959373..4959379 (+ strand) : 7 bp

CDS

chr05:4959380..4959504 (+ strand) : 125 bp

chr05:4959596..4959621 (+ strand) : 26 bp

chr05:4961608..4961697 (+ strand) : 90 bp

chr05:4963663..4963751 (+ strand) : 89 bp

chr05:4964550..4964678 (+ strand) : 129 bp

3'UTR

chr05:4964679..4964946 (+ strand) : 268 bp

FASTA

>Os05t0182500-02 class=Sequence position=chr05:4958343..4964946 (+ strand)
CTACTCGCTA TCCTCCTTCC TCCATGATTC CCTTCTCGAA TCTTCTCACT TTCTTCTGAA GTGCTCCGCT CCGCTCCGCT
CCGATCCAAT CCACTCCGCC CGAGTCCCCC ACCCATCGGC ACCCACCAGC GCGAGGGTGG GTGGCCATCG ATCGATCGGC
CCATCGCCGA TTCCCGCGGG ATCTGCGGCG GCGCGGGGGG ATTTGATCGG AGGTGAGAAC CATTCGCCGT CCTGGTTGTG
TATGGTTCCT CGCGATTGTT CCCTCGCAGA CCGTGAAATT GGTCGTCGTC CGTGGAGGAT CTGTGCGCAT ATGACCGTTT
GTGTCTAGTT GAATTCACAG TTTGTGGTGA TTTGTTTCGG TGATGAGGAT TTGGGGGTGG TGGTAGGCTT TATTTCATGT
TTGTTGGGGG TGATTGGTTG GGGGGAGGAT GAGGGTTGCG GAGGGTATGG GCGATTGATT GGTGGAGTTG TTGCGCTTGT
CTTCGTTGGG GGAAATTTAT GGGTCCAGAT TTGCAGTAGT ATAATGGCCT TGTTGGGTTC ATCGGATGAC CTCGGTCTGT
TAATCTAAGC ATGGGAAATA GGGATGGAAT GGTGTGCTTG TCATGTTTAT GTTTCGCCTT TTCGTTTCAT GGAGATTTTT
TCTCGTGATC ACAGGATGTA TGGGTTGTTT GGAAGGGAAT TCCTGTACCT ATTTGTGCTC AGAGCCTCAG ATGCAACTCT
TGTGCATGTG GGATTCTCCA AGACTCCAGT TACTGGCTGT CCAAACTTAG TCGAGAACAG GACAAACGGA AAATATGAAA
ATTCTCATAT GTTACTTTTG CAACATCCAT AAAAAAATTG TATACCCAAA GCAATTTTTT CTTCTGAAAT TACAGGCTAC
TTCAACACTA TTACTAGCAT AGTGATGAAC TGCCTTGATT GTTAGTATGG ATTGGTCTGG CTAGTAGGTG TCATGGGTAA
ACTAAAGAAT CTCAGTGTAG GTTTCCCATT CCTTCTATTT AGCTTATTTG GTGACTTGGT ATCTACACAG GGTGAATATG
TCGACGCCAG CAAGGAAGAG GTTGATGAGG GATTTCAAAC GACTGATGCA GGATCCTCCA GCTGGCATAA GTGGGGCCCC
ACAGGACAAC AATATAATGC TTTGGAATGC TGTAATTTTT GGGTAAGGTG TTAGACTTAA GAGATATGTT TTATTCCTTT
CGGTTTTATT TTGATCCATT ATACTTAGTT GTCAATTATG TCTTGTTTTG CAGCCCTGAT GATACTCCTT GGGATGGAGG
TAAGGAATTT AAAGTCTTTC CTTTTATTTG GGGTTTGCAT TTGGGACTTG GGAGAGTAAT CACAGGCATG ATATggggaa
atttaactat tttccacttt tagttttggc aattaaccaa atacccttct tagatttgca cttaagaatt tgccactgga
gagagaagct tttgtaattt tttgccactt tctgcACTGT TCAGTGCCAC ATATACATGC CAGCATGGAC CAGGCACACG
AAATGACTAA TCTACCCTTG TTAGTAATGT CTGTAATATA AGCTGAGTCA GGAATAATAT TTGGACAAAT TGCTTTCGCG
AATCAGTTGC ATCGGTATGG ATGCTGTTCA CTTTTATGAG GTACTATATT AAAGACCGAG TACCTCCACA TCAGTTAACA
AATCAATATT TGAAGGAATA GATCCACTGA GATGGTTATA ACAAACTTTC AAAACGATAC TTAGATtgag ttcttttgtt
cactttcaca acttatctct ctcgtttttc atgtgtacgt ttttcaagct gctaaacggt ATTCCAATTT GGCTGGTATT
GTTGGGATGG TGCCACCTGG AGTGAGCTCG ATTAAGGTGT ACGATAGCAT ggtttggaaa tatttctctc ttcacgtaaa
actgagcaaa gaattagcgc atgactaatt tagtttgagt tttaagaaat aaagaataga ttaatatata tttttaaagt
aacttaattt tatttaaaaa gttattaaag aaacGTGCGA AAAAAAATGA GGGAGTAGAA CTCAgactgg cggaggccct
ggttccggtt tttttcagtc caaccgccgg tccggtcggt cctaataact gtgagtagAA GTTAGAAAAA AGACATCCGA
ATGCAGCCTC AGAAAGTTAA TGAACTGACT GTAACATGAA TGGTGCCATT GATGTTGTTG CCTTATAAAT TTAAAAGGGT
AAAATGGGAA GATTGGGCAG GTTGCTGGTT TCTCTTGGTA TCTTTCCAGT GAATGAATTA TGACTAAGAT TCAATGCGGA
CAGGCTTAGC AACTGAGAAA CTTACCACTA GCTAGAAGGG GTAGGTTGGT CATTTTTCAc gttggtccat gttggcatgc
acatgtggca ctccacaggg caaaaagtgg caaaaagtta caaaagcttc tctctctaat ggcaaattct taagtacaat
cttaagaagg gtatttggtt aattgtcaaa tgtaaaagtg gcaaatagtt aaattccccC ATGATATGAC GCATATCTTG
TACTTCATTT TACTTCTGTT TTCATATTCA GAGATAGTTT TGCTTGCATA ATTCCATTTT TGTTGTTGAT ATAACAATTG
GTTCATTTAA TTAATAGGCA CTTAACTTTC TGGACAAATG ATACAATTTA TAATTATCAA ACAAATAGAA TGTATGAACC
TCATTTTTTC TGTCAGTTCA ACCCACATTT CTACTGTCTT TGGGATTTTA TGTCTCGGAA TGTATATTCT ACACTTTAGA
CACTTTTCTT TTTGTCTACA ATGGTCCAGC CTTGGAGCAT GTAGTTCAAA CATTTTAGGT TAATTTTAAT TAAAACTTGT
AATTTTCTTG TCTAATCGAG TGAAGCATGT GTTTTTTTTG GGGTGACATG GTTTGGAGAT CTTATTTTGA TTAATGTTTT
GAATTCAAAT ATATGATAGT CTAAATCGTC AATAAACATT TGTTAAAACC TTTTCATCAT TAGCTGATCA TGTTTTATTG
GTTCTATGAC TGAGAAAGTG CTTGTTTTTT TTAAAGAGCC TCTGTACAAC ATAAATAAGG TGATTAACCC GTTTTAAACA
GTCTGTTGGG GAAGTCCTCT TTGCCAAACG TCCATTTGAT ATTTTTCCTT TTTGTATTTA TTGGCATTTT GTTCTTGTAC
GTGTCACCAA TTGTACTCTT TTACATGTTA ACACTGTCAA ATTATGTTTA CTTCGCCATC GCCAGGTACG TTCAAGCTGA
CACTTCAGTT TACTGAAGAT TATCCTAACA AGCCACCTAC AGTGCGATTT GTTTCTCGGA TGTTTCATCC TAACAGTAAG
CCTCTCTCCC TGCTGTTTAA TACTTGCCTG TGGCATGGTT CCTGTTTCTT ACAAGTTATA AGTATTTATG TGGCATTTCG
GAACAATAGT CTAACATCCC GAGAGACGTA CAATTAAGAA CCAGGCTAAA ATAAGATATG AGAACTAGTG AGACAATTGA
GCTGAATCTG GATGGCTCAT GTCAAGGCCA AATGCTACAG GAAACCTATG ACAGTTCCAC CTCCACCTTC TAGTGACGTT
GGCAGTCCTT TATTCTACAT CGTTGAAAAG CTGACCTAGG TAATTTCTAA ATGTATCAAA CAAGAATCAG CCAAAAAATA
GGATCCAGAA CTAGCGATCT TATTCATGGA TTGGATCTAG ATGCAGCATA GAAGGCCACC CTGATTCTCC TTGCTTCCAT
GCCATCCAAA ATTATTTTGG TCACTGAGAT CAATGTTCTA GTTATCCCAT TTTAGTTTCT TTTTCTATCT AATGCAGAAG
TTGGTTGTTA AGGCGGTAAG GCATCCTAAG GCGACCCCGG ACTGCCTTAT CGCCATAGCG GTAAGGCGTA AGGCGAGGCG
ACGCCTTAGG CACTCCATAC CAATTAGATG ACAAACAAAA TAATCTAATA TGATAGCAAA TCAAAGCTTG GCAACTCTTG
AGCCCACTAG ATGGTTGTAA TAATTACTTA ACCAGATATC AATTTATTAA CTAAAAGAAC ACCATCCTAT AAATACAGAG
TGAGGGTGCA TGGGGGAAGA GCAAACGGGG TAAATATGTG CTAAGTACTA ACTACTAACA GGGAGTCAGG GATGTAAGCG
AGGGGCAGGG AGTAAAACAG AGCAGTAGAG GGAGGATTAT AGTAGATGAG ATGTAGAGGA GAGGGAGGAA AACCACAACA
TAGCAGCAAA TGAGGGAGCA GAGTAGAGGA TGTAGAAGAG GGGGGAGGAA ACACCAAAAC AAGCAGCAGA GGAAGGATAA
GAACAGGGTA GAGGAAGGAG CAAAGCAGGA TCATGTAGAG CAGAGAAAGA AACAGAGGAA AGAAGAGGGT GGAGGAAAGA
GGAGAAAGAA GAGCGTGCCT GCTTAGTTTT TGTGTCAATG GTGAGGACCA GGATGATGGC GCAGGTGCAG AGGACCAGGA
CGATGGCGCA GGTGCAGAGG ACCAGGACAA TGGTGCAGGC ACAGGATAGC CGCAGGCAAC AACTTGGATC GCCGCCAGGG
ATGGAGATGT CGCGAGGGAT GGATCGCCAC AGCCTCAGAC TCCAGCGACC CTCTTTCTGT TGTTTTCTCC TTGATTTGGT
GGGATATGGT GCGTGGGGAC CTTTTCACCC CAAAAATTGG CGCTTCTGTT AGTTCTGTTT CACGCCCAGG GCCCATGGCG
CCAATTTTTT CGGGCTCTTC AACCAATCGC GGCAAAAACC ACGCCCTCGA CTTCCTGTGG CGTTGCCTTT AGCCATTGTA
GCGCCTAAGG ACGCAATATC GACGCCGTAG CGGCGCCTTG GGCATAAGGC GGACGCCATA AGCAATATGG TAAGGCGGGC
CAGACGCCCT GACTCCTGGC AGCGCCTTAC CGCTATAGCG ACGCTATGGC GATGCCTTGA CAACCAGCAG AACATTGAAT
AAGGTATCAA ATATCCAATT GTTGCAATTA TGCTGTTATG GGCCTCATCG CAGGCAGTTA AGAGTATACT AGCAAATACG
CAGATCCAAT TAGTACTTGT TTGATTTGAT GACTAGCTTT GCTCTCGAAT GTCATAATTG ATGACTAGTA TAAGTTTACT
TGCATCAAGA TATAAAGGAC TTTACAGATA TGCAGTATAT CTGAAGCTTA TTTAATGCTT CATACAATTT ATGTAAATAC
TTAAAAAGAT CGACTTCTTT TGCTACTTGT GTGGAAGCAC TTATGTACCT TAGAATAGCA TGATATTGTT GTATCTCCAT
TTGTTTTACT TTCCTAACAT TTTCCTTTTA TCATGTACAG TTTATGCTGA TGGGAGCATA TGCTTAGATA TACTACAAAA
CCAGTGGAGC CCCATATATG ATGTAGCTGC TATACTCACA TCCATCCAGG TAGATGATGC CTTTTTTGGG GGTATTAGCA
TGTCATGATG TCCTGTCATG TTTGTTGCAA TATTTTGTAT CATGTTTATA ATTCGTGCTT CTGATTTTGG TCCTGTCTTT
AAAAATATTG AGCAAACTCA CCAATCTAGT ATAAGTGAAT TGTCACTAAC TTAATTGTTG TCGCCTTAAA ATACACATGG
TGTTTCCTTA TAGATAGTCT GCTTTTCCTC CCCACATGCT CCATTGTTAA GTAGTAAGCT ATATTCACTT GAATAATTAT
TTTTCTTTGT TAGAGGCACT ATCACGCGAT ATACCTGTGG AAGGGTTTCA TCTTGAGAGT AGAGATATTA GGCCTCTGTG
ACTGATTATC ACTATTCAGT ATTAAGTGAC ATTGGCACGT GGGGTATATA TACATAAAAA AGAATAATAT TTCCAGCCTC
TGCTTAGTTT TTGATTCTGG TGACAACTAT ATATAGGCCA CGAAGAGTAG ACGGCTAACT TCTATATGTA GGCAAACTTC
TATAACAGTA ACTTTAGTGT GGTGAGGCCG CCTGTCAATA ACAACATATT ATCTTTATAT GTTTTTCATA TACATGGTGA
TATTTATTAA TCTATGCTCT ATGGAAAATA GTATAGAACA CAATAATTTT TATATCAGTT GGGATACTTG CATATCTTGC
TTCTGTGAAT AACAAATGCA TATCACAACA ATGCATATTT CATGGACTCA AGACATTGAC ATATTACAGG CAATTTCATT
GATTTAACTG TTCAGTACTT CTATTTCCTG CTTTGTATTA TTTCCAGTCG CTGCTTTGCG ATCCAAACCC AAATTCACCT
GCCAACTCTG AAGCTGCCCG CCTATTCAGT GAGAACAAGC GGGAATACAA CCGAAAAGTT CGTGAGATAG TGGAGCAGAG
CTGGACCGCG GACTGATCCA CTCCATCTAA CCATATGATG CCTGATACTT AAAACGCTCA TCTTTTCAGT GTGTCGTGTA
CCAAACTGCT TGTAATTAAA ATGCTAAAAC AGTAAAACGT GCTTACTGTT ATGTATGCCC TTCCCGAATA CGAGGAAGGC
TTTGGACCAT GTTGAGGACC ATATGGACTT CTTATATAAC ATCTATTGTT GCCAGCTACT AAGTGTTAAA TGCTATATTG
AGTACGAAGC CGTGCCTAAA ATTCAATGAG TAATTCTTTT CGCC

Locus: Os05g0182500

Loading...

Locus: Os05g0182500

Loading...