Os05t0182700-01

Locus

Os05g0182700

Description

Protein of unknown function DUF1664 family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

EP

Oryzabase Gene Name Synonym(s)

Expressed protein

Transcript Evidence

AK065911 (DDBJ, Best hit)

AK104343 (DDBJ, Best hit)

Protein Evidence

A2Y139 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Protein of unknown function DUF1664 (IPR012458)

Full-length cDNA

J013045E01 (Online Clone Ordering)

001-034-B09 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0182700-01)

Others

Oryzabase (21964)

Transcript

1378 bp

>Os05t0182700-01 Protein of unknown function DUF1664 family protein.
CCCAAATCAGCTAGAGTGGTCGGCTCGACCCCTCCTCCAcgcctccgcctccgcctccgc
ctccacgacgtagcccagggcggctagggtttcggtttcctccgccgccgccgccacctc
ctcctcctcctcgtgcgcggcggcgaccatggcgatggtgcaggccggcatgggcctcac
ccgcgtcgttgtcctcatcggcgccgggatggccggctccgtcgtcctccgcaacggccg
cctctccgagatcctcggcgagctccagGAGATACTGGACAAGGGGGAGAAGGGGAAAGA
CGGAGAAGGGGGCGGGGGCGCCGACATGACGGACGCGCTCACTAGACAGGTGCGCAACTT
GGCTATGGAGGTTAAACAACTTGCTTCTTCCCGTGGATCTATAACTGTTCTTAATGGAGG
TTCTGGTCAAACAGGGGTGTCAGGTTTGATAGTACCTGCAGCAACTGTTGGAGCACTCGG
TTATGGTTACATGTGGTGGAAGGGCATCTCCTTTGCGGACCTAATGTATGTGACTAAGCG
TAACATGGCAAATGCTGTTTCCAGTATGACTAAGCATCTGGAGCAAGTGCAAACCTCTCT
TGCTGCTGCTAAAAGGCATTTGACTCAGCGTATTGAAAGGTTGGATGATAAATTGGATCA
GCAAAAGGCGCTTTCTGGACAAATAAGAGATGATGTTACTGATGCACGACTGAAGCTTGA
GAATATTGGTTCAGAAATTAAGAACATCAAACAATTGGTTTGGGGTCTGGATGAAAAAAT
GGATTCGATGGAAGCCAAACAGAACTTTTCATGTGCTGGTGTGATGTACCTCTGCCAATT
TATTGAGCAAAATGGTGGAAAGCTGCCAGAACGCCTGGAAGGCTCAAAAATGGCTGGGAA
GCGTTTTGGAAGCCAAAATCTCATACAGGGGTTGCAACTGGCCATAGAAACAGGGAATTT
TGACAAGGAAACGTTCAATGCACTTAAGAACAACTCTGATTCAAGATAAACAGGTCCAAC
GTCTGCCAAAGTAATTTTTGTCAGGGCGGTATCCGAGGGCATCTCATCTTTCCAGACCAC
GCCCTCCATTGAAATGCTGTAAAGGATAATTTCTTACTAGTTTAACATGTAAAAAGTTCC
AGCCTTTTCAAGTTTTCTGCTTGCAGAAGGTGCTGCTACATTTTAAAGCTTGTGCAATAC
TTAGTGGTTAGGGTTTTTTTACCGTGCTATGCTGGCACCGCTTGTGGTTTCAGAATTTCA
GGCAACACTTTGCCGTAAATAAAAGGACAACACGTGTGGTTCGTGTGATGTTTTCAAACC
CATTTCATGTTTTATTTGTAATATATGCTACAAGCTTACGTAGATTTTCAAGTCGGCT

CDS

861 bp

>Os05t0182700-01 Protein of unknown function DUF1664 family protein.
atggcgatggtgcaggccggcatgggcctcacccgcgtcgttgtcctcatcggcgccggg
atggccggctccgtcgtcctccgcaacggccgcctctccgagatcctcggcgagctccag
GAGATACTGGACAAGGGGGAGAAGGGGAAAGACGGAGAAGGGGGCGGGGGCGCCGACATG
ACGGACGCGCTCACTAGACAGGTGCGCAACTTGGCTATGGAGGTTAAACAACTTGCTTCT
TCCCGTGGATCTATAACTGTTCTTAATGGAGGTTCTGGTCAAACAGGGGTGTCAGGTTTG
ATAGTACCTGCAGCAACTGTTGGAGCACTCGGTTATGGTTACATGTGGTGGAAGGGCATC
TCCTTTGCGGACCTAATGTATGTGACTAAGCGTAACATGGCAAATGCTGTTTCCAGTATG
ACTAAGCATCTGGAGCAAGTGCAAACCTCTCTTGCTGCTGCTAAAAGGCATTTGACTCAG
CGTATTGAAAGGTTGGATGATAAATTGGATCAGCAAAAGGCGCTTTCTGGACAAATAAGA
GATGATGTTACTGATGCACGACTGAAGCTTGAGAATATTGGTTCAGAAATTAAGAACATC
AAACAATTGGTTTGGGGTCTGGATGAAAAAATGGATTCGATGGAAGCCAAACAGAACTTT
TCATGTGCTGGTGTGATGTACCTCTGCCAATTTATTGAGCAAAATGGTGGAAAGCTGCCA
GAACGCCTGGAAGGCTCAAAAATGGCTGGGAAGCGTTTTGGAAGCCAAAATCTCATACAG
GGGTTGCAACTGGCCATAGAAACAGGGAATTTTGACAAGGAAACGTTCAATGCACTTAAG
AACAACTCTGATTCAAGATAA

Protein

286 aa

>Os05t0182700-01 Protein of unknown function DUF1664 family protein.
MAMVQAGMGLTRVVVLIGAGMAGSVVLRNGRLSEILGELQEILDKGEKGKDGEGGGGADM
TDALTRQVRNLAMEVKQLASSRGSITVLNGGSGQTGVSGLIVPAATVGALGYGYMWWKGI
SFADLMYVTKRNMANAVSSMTKHLEQVQTSLAAAKRHLTQRIERLDDKLDQQKALSGQIR
DDVTDARLKLENIGSEIKNIKQLVWGLDEKMDSMEAKQNFSCAGVMYLCQFIEQNGGKLP
ERLEGSKMAGKRFGSQNLIQGLQLAIETGNFDKETFNALKNNSDSR*

5'UTR

chr05:4971602..4971749 (+ strand) : 148 bp

CDS

chr05:4971750..4971869 (+ strand) : 120 bp

chr05:4972040..4972120 (+ strand) : 81 bp

chr05:4972815..4972899 (+ strand) : 85 bp

chr05:4973313..4973380 (+ strand) : 68 bp

chr05:4973622..4973723 (+ strand) : 102 bp

chr05:4974018..4974107 (+ strand) : 90 bp

chr05:4974350..4974424 (+ strand) : 75 bp

chr05:4974500..4974532 (+ strand) : 33 bp

chr05:4975011..4975085 (+ strand) : 75 bp

chr05:4975672..4975722 (+ strand) : 51 bp

chr05:4975965..4976045 (+ strand) : 81 bp

3'UTR

chr05:4976046..4976049 (+ strand) : 4 bp

chr05:4976150..4976514 (+ strand) : 365 bp

FASTA

>Os05t0182700-01 class=Sequence position=chr05:4971602..4976514 (+ strand)
CCCAAATCAG CTAGAGTGGT CGGCTCGACC CCTCCTCCAc gcctccgcct ccgcctccgc ctccacgacg tagcccaggg
cggctagggt ttcggtttcc tccgccgccg ccgccacctc ctcctcctcc tcgtgcgcgg cggcgaccat ggcgatggtg
caggccggca tgggcctcac ccgcgtcgtt gtcctcatcg gcgccgggat ggccggctcc gtcgtcctcc gcaacggccg
cctctccgag atcctcggcg agctccaggt gcgtcgcgtc tccaccgcct TGGGGGGAAG AATCCCCCGC TCTTCCTCCT
CACCTGAATC GGTGATCCTG GTCCTGGGAG AGGTGGCGGC GCGCCACCGG ATTGGATTTT GATTTGGTTT GGTTCTGATG
ATGATCCGTG CCTTGCGGAC CTCTCTCACT CGTTGCAGGA GATACTGGAC AAGGGGGAGA AGGGGAAAGA CGGAGAAGGG
GGCGGGGGCG CCGACATGAC GGACGCGCTC ACTAGACAGG TGCGTCGGTG ATCTCCCTGT CCCTAGATGT TTCAGCTAGT
ATATGCTCAG GGATGTGTCC GATTCAGCTG TTCGATTGAT TATTGCGCCA TTTTTCTTTG CCATTAGTTA GGTGCTCTGG
CTTCCCCACC AGAGCCCCAT GTCAATAGGA GAAGCATGGG ATGCATTTTA ATGCGATTAT TGTATTTAAA AATGGATGTT
ATCTGTGCCT ATCAGTATAT GTATCTATAG CTGCAGTGAT TGCTGAATTA TTGTTTTATA GTGGCAATGA TTCACATTGC
ATTGAGTCAG TTCTGCTTGT ATTTTTTCTT ATTTCTGGGA ATTGCTAGCT TCAACAATGC ATTAGTTGTT CTTCCATTAT
GTATAAGTTA ATATTGTCAT GTGATACATT AGGTTGTGGC CTTGGCATTT CTACGTTCAC AATGAAGAGC TGTTGAGTAT
TTTTGGAAGT GTATAGTAGC TGTTGTAATA TTAATTATTA CTACAAGCCA CAACACAAGT GTGTGCTCAT AAGAAGCATT
CTGCGTGTGT TTTAAACAGC TGTGGTATAT GCAACAGTAA ACATACTACT TCAATATTCC CATAATATTT TTTTCATTGT
CATTTATGAG TAAAACAGTT TGCCTATCTT CATACACATA TTTGATACTT TGTTTAATTT TGTCAAGCTA GACTTACACC
TTGGTCCATT TAGGTGCGCA ACTTGGCTAT GGAGGTTAAA CAACTTGCTT CTTCCCGTGG ATCTATAACT GTTCTTAATG
GAGGTTCTGG TCAAACAGGT CAGtctagct tctgcacaac ctacataact gttacttcct cagtctagac atatatgtgt
gccttgattc attaacatct atatgaatgt gggcaatgct agaaagtctt ataacctgaa acggaggtag taAATCACAA
GCTCCACCCA TTTTATTTGC CCTCTTTTTT TCTTTTCTTT CTTGTAGTGT TCTGACATGA GTATTACTTA TCGCTTGGCT
TCATTTTCTC TTGTTTTAAA TTTGAAAGAA TTCACGTAGT TAGGGAATGA GTGGACTGAA CAATAATCAT TACTCACTAA
TTCAGCCTAC ATATTTCTGT TGTAGCTTAT TTCAGAAATT GGCTTAATTA ACCAGTGACC TCTTTGATCA GACATTCATG
ATGTTAGTGT TCTTGATCTT CTTTTTTGCA GGGGTGTCAG GTTTGATAGT ACCTGCAGCA ACTGTTGGAG CACTCGGTTA
TGGTTACATG TGGTGGAAGG TATGCTGTAC TTCTATCATA GCCTTTATGT TTGTGTTGTG ATTGTAATAG AGTAACTGCC
AAATTGTAAG ATCAGCTTTA ATTTTGGCTG CTATTTTTTT TATCAGAAAC CAAACCTAGT TAACTGCTAT TTCTTCAGCT
GGTCTTGTTC TGTTGAATTG TTTTTTATGT CTTACATCGG CAGTAGAAAC TCTTTGGAAG AACAATTCAT TAATATGTTT
TGATTGTATT TGTTATCCAG GGCATCTCCT TTGCGGACCT AATGTATGTG ACTAAGCGTA ACATGGCAAA TGCTGTTTCC
AGTATGACTA AGCATCTGGA GCAAGTGCAA ACCTCTCTTG CTGTAAGTCT TACTGTTACA AGTTTCTTTC CTAGTTCATC
ACGAAGCATT GCTTTTTCAC TTGTCTGTGA GAGTATGGAG TGTATACTAA TAATCTATGC CAGGACGAGT TTAATGCATC
CTAATTCATC TGCATCTAAC GTCCACATTT TCATCTTAAA AACAATCCCT GTATACATTT TCATCATATA GAACATCACA
GAATTCGGTT GTATGTCACT GTTGAGATGT TTGGTAGTTT GTTGTACAAT TTCTGAGATC CTCAATTGTG AAACAATTTT
CTTGATTGTC ATGCAGGCTG CTAAAAGGCA TTTGACTCAG CGTATTGAAA GGTTGGATGA TAAATTGGAT CAGCAAAAGG
CGCTTTCTGG ACAAATAAGA GATGATGTAC TTTCTCCTTA ACATTCATAT CAATCCATGT TTGGCATTAA CATGTCTTCA
TTTTCACGCG CATGGGTTGA ATAATTAAGA AATGTCTAGT AGCATATGCC TATATGCAAT TATTAGCCCA ATTATATTTT
AAGATGCACT TTTTATTTCT TTTTAGGGAA GTGAACTGTG AGAACTTACA GCTAAGTACA TTCTTGTTGT ATCATTTTCA
CTTTTCAAAT ATCTACTTTT TTATCCAGGT TACTGATGCA CGACTGAAGC TTGAGAATAT TGGTTCAGAA ATTAAGAACA
TCAAACAATT GGTTTGGGGT CTGGTTAGTG TATTTCTTCC CAGCCATTCT TTATAATTGC CTTGTTCAGG TTGTTTCAAT
CCCCTTTTGC TTCTGCAGGA TGAAAAAATG GATTCGATGG AAGCCAAACA GGTTGGCCAC TTGGCATTCA CTTAGAAATG
TTTGTGTGTT ATTTCTGTCC TTTTAGTTTC ACTATTTTCT TTTTGCATAG AACAATGCGG TAGTGCATTC TAAGGGTACC
GGTTTTAGCC TGGGCAATGA TATTCTGAGT TGGAAATACT CCTGACTCGA TGTGTGTTAG CCTCATGTCC CAACCTTAGT
GAAAAGTGGA GATTGGCTGG CTTGAAATTT GCTGGGGAAG TAATGGAATT AGCTCTTCAG ATTTTTTTAG TGCATGCTGC
ACTTTATTGA ATTTGTTTGG TGATTGGACT GAGACGGCAG CCCTTATCTC TTTTGTTCCA ACTATACTTT GATAAGAAAG
ACATCTGTTA CACCAAACCT AGTGTTCTTT TCATCCTATT GAAGGTTGAA TTTACATGTA TTCAGTTTAT ATGGCAAGCT
CCTTGAACCT TGGTTTTTGT TATAATGACT AATTATATTT TATCAACAGA ACTTTTCATG TGCTGGTGTG ATGTACCTCT
GCCAATTTAT TGAGCAAAAT GGTGGAAAGC TGCCAGAACG CCTGGTATGA GCCTGAGCAT TTATTATACA ATTCCCAGTT
CTGGCTTAAT TATGTGTAAC TTATCAACTA TTCTGTTCTT TTCATATGTA TGCCTTGTGC TTATATGACA TCCCTTTGAT
GACAAGTCAT GCATTCAGTT GCCACTTTTG TTTAAATTTG ATTTTCTAAG GATATTTATT GAATGTTAGT ATTGCAGAGT
ATTTCTATGG TGTTGTAAAT TGCAGTTAAG TAGCATGTAT gggcatgttt ggattgatgc ccaaataagc ctgactaaaa
ttttggcaag accaatgcat ttagccattg tgtggttcat tgccaaagct aaaaaatttg gttacattgt ttagtctctt
gttggtctca aactaaacaa ccaaagcagc tctgccaaaa ttttgccaac aaactaaaca ctcaacttta ccaaaatttt
ggcaatgccc atatttTTGA CTTGCAAATA TTTTGCTAAG TTTGAGATGT CTATAAAGCA AACAAACTTT ATGTTCTTTA
TATTTGGTAT GGTGTATGCT ATGTTCAGTT TTTATCCACT TCTCTGAACT TCTTTGTTCA ATTTGTACAG GAAGGCTCAA
AAATGGCTGG GAAGCGTTTT GGAAGCCAAA ATCTCATACA GGTTAGTAGT AACATTGAGA GATGGTGGCA CCACAAGTTG
ATTCTCAATC CTGATTTTCC TACCCAAAAA ATGCTCAAGG CAATTGCACT TAAAATATTT GTGAGATTTA TGAAAAATTC
CTGTTGCCAA TATCTCGGAG AAGTGTTCTG ATTTCATTAC CTTAATTGAA CCTACCAACT AAGTCTGGAT TTAAATATTT
TTGGCGCTGG TGCTGATAAT GGCCTTGTGC CACTGCTTTT CAGGGGTTGC AACTGGCCAT AGAAACAGGG AATTTTGACA
AGGAAACGTT CAATGCACTT AAGAACAACT CTGATTCAAG ATAAACAGGT TCGAGGACTG ACCCTTTGCA TGTTGTTGCC
TGAGCAGCTG AGCTTATTAC TTACAGAGTT ACAGTCATGT TCTGAAGGAA TGACCAACAA TTTTATAGGT CCAACGTCTG
CCAAAGTAAT TTTTGTCAGG GCGGTATCCG AGGGCATCTC ATCTTTCCAG ACCACGCCCT CCATTGAAAT GCTGTAAAGG
ATAATTTCTT ACTAGTTTAA CATGTAAAAA GTTCCAGCCT TTTCAAGTTT TCTGCTTGCA GAAGGTGCTG CTACATTTTA
AAGCTTGTGC AATACTTAGT GGTTAGGGTT TTTTTACCGT GCTATGCTGG CACCGCTTGT GGTTTCAGAA TTTCAGGCAA
CACTTTGCCG TAAATAAAAG GACAACACGT GTGGTTCGTG TGATGTTTTC AAACCCATTT CATGTTTTAT TTGTAATATA
TGCTACAAGC TTACGTAGAT TTTCAAGTCG GCT

Locus: Os05g0182700

Loading...

Locus: Os05g0182700

Loading...