Os05t0183100-01

Locus

Os05g0183100

Description

WRKY transcription factor, Positive regulation of blast and bacteria blight resistance

RAP-DB Gene Symbol Synonym(s)

OsWRKY67

RAP-DB Gene Name Synonym(s)

WRKY GENE 67

CGSNL Gene Symbol

WRKY67

CGSNL Gene Name

WRKY GENE 67

Oryzabase Gene Symbol Synonym(s)

OsWRKY67

Oryzabase Gene Name Synonym(s)

Rice WRKY gene67

Transcript Evidence

AK066252

Protein Evidence

Q65WY5

Literature

PMID: 30367631

PMID: 29375598

Rice WRKY Working Group 2012. Rice 5:3.

Note

Manual Curation

November 7, 2018

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA-binding transcription factor activity (GO:0003700)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

WRKY domain superfamily (IPR036576)

WRKY domain (IPR003657)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

J013052M10 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0183100-01)

Others

Oryzabase (6582)

Transcript

791 bp

>Os05t0183100-01 WRKY transcription factor, Positive regulation of blast and bacteria blight resistance
ATCCATTACCATCACAGAAGAAAATTCACCGGTGAAAAGGTTCAGCACTGTGCAATGGCG
GCTTCCGTAGGACTGAACCCTGAAGCTTTCTTCTTCAGCAACTCCTACTCCTACTCCTCA
TCCCCTTTCATGGCCAGCTACACGCCGGAGTTCTCGGCCGCCGCTATCGACGCCAACTTA
TTCTCCGGCGAGCTCGATTTCGACTGCTCTCTCCCAGCTCCGGCCCAGGAGTACCCGGAA
AATGAAAACACTATGATGAGGTACGAGAGCGAGGAGAAGATGAGGGCGAGGGTGAACGGG
AGGATCGGGTTCAGGACGAGGTCGGAGGTGGAGATTCTTGATGATGGCTTCAAGTGGAGG
AAGTACGGCAAGAAAGCTGTCAAGAACAGCCCAAATCCAAGAAACTACTACCGGTGCTCG
ACGGAGGGGTGCAACGTGAAGAAGCGAGTGGAGAGAGACCGGGAGGACCACCGCTACGTC
ATCACCACCTACGACGGCGTCCACAACCACGCGAGCCCCGCCGCCGCCGCCGCGGCGCTG
CAGTACGCCGCCGCCGCCGGCGACTACTACAGCCCGCCGCTCAGCAGCGCCGGCTCGCCG
CCGGCCGCCTATTCGGCAGGCGGCTCGCTGCTCTTCTGAGGCTGATGAGTTTGTCTAGTA
CTAGACACGCCCGGGAGCTCTAGCTAGGATAGAAAACTAGAGAAAGTTTAATTATACCTG
AATTTTAATTAATCACCTCACAAAACTCTGATGTATCATATTATATCGTGATAGTGACTG
CTTGTTAATTT

CDS

585 bp

>Os05t0183100-01 WRKY transcription factor, Positive regulation of blast and bacteria blight resistance
ATGGCGGCTTCCGTAGGACTGAACCCTGAAGCTTTCTTCTTCAGCAACTCCTACTCCTAC
TCCTCATCCCCTTTCATGGCCAGCTACACGCCGGAGTTCTCGGCCGCCGCTATCGACGCC
AACTTATTCTCCGGCGAGCTCGATTTCGACTGCTCTCTCCCAGCTCCGGCCCAGGAGTAC
CCGGAAAATGAAAACACTATGATGAGGTACGAGAGCGAGGAGAAGATGAGGGCGAGGGTG
AACGGGAGGATCGGGTTCAGGACGAGGTCGGAGGTGGAGATTCTTGATGATGGCTTCAAG
TGGAGGAAGTACGGCAAGAAAGCTGTCAAGAACAGCCCAAATCCAAGAAACTACTACCGG
TGCTCGACGGAGGGGTGCAACGTGAAGAAGCGAGTGGAGAGAGACCGGGAGGACCACCGC
TACGTCATCACCACCTACGACGGCGTCCACAACCACGCGAGCCCCGCCGCCGCCGCCGCG
GCGCTGCAGTACGCCGCCGCCGCCGGCGACTACTACAGCCCGCCGCTCAGCAGCGCCGGC
TCGCCGCCGGCCGCCTATTCGGCAGGCGGCTCGCTGCTCTTCTGA

Protein

195 aa

>Os05t0183100-01 WRKY transcription factor, Positive regulation of blast and bacteria blight resistance
MAASVGLNPEAFFFSNSYSYSSSPFMASYTPEFSAAAIDANLFSGELDFDCSLPAPAQEY
PENENTMMRYESEEKMRARVNGRIGFRTRSEVEILDDGFKWRKYGKKAVKNSPNPRNYYR
CSTEGCNVKKRVERDREDHRYVITTYDGVHNHASPAAAAAALQYAAAAGDYYSPPLSSAG
SPPAAYSAGGSLLF*

5'UTR

chr05:4999573..4999626 (- strand) : 54 bp

CDS

chr05:4999373..4999572 (- strand) : 200 bp

chr05:4999136..4999282 (- strand) : 147 bp

chr05:4998461..4998698 (- strand) : 238 bp

3'UTR

chr05:4998309..4998460 (- strand) : 152 bp

FASTA

>Os05t0183100-01 class=Sequence position=chr05:4998309..4999626 (- strand)
ATCCATTACC ATCACAGAAG AAAATTCACC GGTGAAAAGG TTCAGCACTG TGCAATGGCG GCTTCCGTAG GACTGAACCC
TGAAGCTTTC TTCTTCAGCA ACTCCTACTC CTACTCCTCA TCCCCTTTCA TGGCCAGCTA CACGCCGGAG TTCTCGGCCG
CCGCTATCGA CGCCAACTTA TTCTCCGGCG AGCTCGATTT CGACTGCTCT CTCCCAGCTC CGGCCCAGGA GTACCCGGAA
AATGAAAACA CTATGTAAGA AGGTATTTTT GGTGTTGGAT ATATTGATTG ATTGATGGAT TAAAATTGGT ACTGAATTGT
TTTTGTTTGA TTTGATTTTA TTAGGATGAG GTACGAGAGC GAGGAGAAGA TGAGGGCGAG GGTGAACGGG AGGATCGGGT
TCAGGACGAG GTCGGAGGTG GAGATTCTTG ATGATGGCTT CAAGTGGAGG AAGTACGGCA AGAAAGCTGT CAAGAACAGC
CCAAATCCAA GGTACACGAA TATTGACGTC ACTGCCACTA TGCCCATTTG GCTATCAATC TTAATTAATT AGTACCACAA
GTTTAATCAC TAGCTTAATT ACTGGCGTTC TGGCCAATCA AAGTTTTATA ATCACCTTTT CTGAAATATC ATCTGTTCAG
GGTTAAAAAT TTTAGAATGC AAAAAAATTG CGGAGATTTT GAACTGAATT TTCAGACAAA TTTTGTAATT TGAACAGGTT
TTCACTTTAC TTGAACCGAA TTTGAGAAAA TTCAATCAAA TTCAGAGTGT TTGGTCGGTA TTACTTCCTA CCGGGACTCA
CTGATAGACC CAAATTGAAT TTCATTCTGA AAACTGTAAA CCTTAGGAGT GCTTCGGACG AAATTTCGTT CCAAATTAAA
TTTGCATTGG ATGATGAAAT TCATCAATCT CCCTGTCAAT TTTTTCAGAA ACTACTACCG GTGCTCGACG GAGGGGTGCA
ACGTGAAGAA GCGAGTGGAG AGAGACCGGG AGGACCACCG CTACGTCATC ACCACCTACG ACGGCGTCCA CAACCACGCG
AGCCCCGCCG CCGCCGCCGC GGCGCTGCAG TACGCCGCCG CCGCCGGCGA CTACTACAGC CCGCCGCTCA GCAGCGCCGG
CTCGCCGCCG GCCGCCTATT CGGCAGGCGG CTCGCTGCTC TTCTGAGGCT GATGAGTTTG TCTAGTACTA GACACGCCCG
GGAGCTCTAG CTAGGATAGA AAACTAGAGA AAGTTTAATT ATACCTGAAT TTTAATTAAT CACCTCACAA AACTCTGATG
TATCATATTA TATCGTGATA GTGACTGCTT GTTAATTT

Locus: Os05g0183100

Loading...

Locus: Os05g0183100

Loading...