Os05t0186900-01

Locus

Os05g0186900

Description

Similar to Auxin-responsive protein IAA16.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IAA16

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIAA16, DLN134, OsDLN134

Oryzabase Gene Name Synonym(s)

Aux/IAA protein 16, DLN repressor 134, DLN motif protein 134

Transcript Evidence

AK111403 (DDBJ, Best hit)

Protein Evidence

P0C127 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Full-length cDNA

002-182-E05 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0186900-01)

Others

Oryzabase (10905)

Transcript

1494 bp

>Os05t0186900-01 Similar to Auxin-responsive protein IAA16.
ACACTTCACACTTCTTGTTTGATCAATCACAGAGACAGAGAGAGAGAGATGGCTTGGAAT
GGCAGGTTTGGAGAGGATGGAGAGGAAGAGAGGAGCCTTGAGCTCAGCCTTGCCCTCCCT
GGATACTTCTCCAGCTCAGGTCACCACCTCCCTTGCTCTCTTCTTGATTCATCTTGCCCT
CAAAGTTTCCTGCTTTGTTTGATCATATCTGTGTGTTTTGTCCTATGCTTTACATTTCTG
GTGGATTTTCATTTCTCAGGTTTGCAGGGGAACACGAGCACTGCTGCTGATGGAGCCAAG
GGAAACGATGGGTTCAAGGCAAGGTGATGAAAATTTTCTGGTTTTTTTTTTGGGAGCAGT
CTGTTTGCTCGCAACAACATTTTTCTGACGAATCTGCAGCAAAAAGATGCTAAAATTTGC
CCCTAAATTCTCTGCGATTCGCAGCAGGCCGGCGGCTCCGGTGGTCGGGTGGCCGCCGGT
GCGGTCGTTCCGGCGGAACCTCGCCTCGTCGTCGTCGTCGTCGAAGCCGCCGCGTGGAGG
CCGAGACGCCGCCGCCGCCGCCACGGGAGGCAAGGTGGCCCGGTTCGTCAAGGTGAACAT
GGACGGCGTCCCGATCGGCCGGAAGGTCGACCTGGCGGCGCACGGCGGCTACGGCGAGCT
CTCCGCCGCCGTCGACCGTCTCTTCCGCGGCCTCCTCGCCGGTAAACCCCACCACCTCGA
CATTATATATCATCGGAGTTTTCTATCTCGAGCTTTCTCTTGATGGTGTTTGCTCGCTTG
CTTGCTCGCGTTGGCAGCTCAAAGGGACCCAACCATGGCCACCGCCGCCGCCGCCGCCGC
TGCCGGCGAGAGCTGCACAGGAGAGGAGGAGGCGATCGCCGGGCTCCTCGACGGCGGCAG
CGGCGAGTACACGCTCGTCTACGAGGACGACGAGGGCGACCAGATGCTCGTCGGCGACGT
GCCATGGAAGTGAGTCCGACACACACACACACCATGAATGAATCTCTCGTCTTCTCCAAA
GCTAATGGCGACGAATTCTTGATTGATTGCAGCATGTTCATCGCCGCGGCGAGGAGGCTG
CGCGTGCTCAGGAGCTCCGACCTGAACGCCTCCACGGTCAGCGAAATTTCTGGTTTTCTG
CTCCTTTTTCTTGAGAAATTTGATCGATTCTGACCCGTGATTTTTGTTCTTGATCTTGTT
TTTGCAGATACGAGCAGGGAGCAGGAAGAGGGCAGCTGCCGAGTGATCTTGATCTTGTTT
TTTTCATCGCCGGGAGCAGAGCAGGAAGCATATCTGCATAGTGATTATGATAGCTCTCTG
TTTTGTTTTTAATCCTTTTCTCTTCGCGTTCTTGGAAGATTTTTGTGTACAAAAATGCGC
AAGAAGCGTCTTTTTTTGGGGATCATGATGTTGTCGACTACGACTAGGACAAGATGTAAT
CGAGAATGGAAATTGTTAGTACTATTAATTAGGATCAAGTTCATCTGTTCTTGC

CDS

279 bp

>Os05t0186900-01 Similar to Auxin-responsive protein IAA16.
ATGGCTTGGAATGGCAGGTTTGGAGAGGATGGAGAGGAAGAGAGGAGCCTTGAGCTCAGC
CTTGCCCTCCCTGGATACTTCTCCAGCTCAGGTCACCACCTCCCTTGCTCTCTTCTTGAT
TCATCTTGCCCTCAAAGTTTCCTGCTTTGTTTGATCATATCTGTGTGTTTTGTCCTATGC
TTTACATTTCTGGTGGATTTTCATTTCTCAGGTTTGCAGGGGAACACGAGCACTGCTGCT
GATGGAGCCAAGGGAAACGATGGGTTCAAGGCAAGGTGA

Protein

93 aa

>Os05t0186900-01 Similar to Auxin-responsive protein IAA16.
MAWNGRFGEDGEEERSLELSLALPGYFSSSGHHLPCSLLDSSCPQSFLLCLIISVCFVLC
FTFLVDFHFSGLQGNTSTAADGAKGNDGFKAR*

5'UTR

chr05:5329989..5330036 (+ strand) : 48 bp

CDS

chr05:5330037..5330315 (+ strand) : 279 bp

3'UTR

chr05:5330316..5331482 (+ strand) : 1167 bp

FASTA

>Os05t0186900-01 class=Sequence position=chr05:5329989..5331482 (+ strand)
ACACTTCACA CTTCTTGTTT GATCAATCAC AGAGACAGAG AGAGAGAGAT GGCTTGGAAT GGCAGGTTTG GAGAGGATGG
AGAGGAAGAG AGGAGCCTTG AGCTCAGCCT TGCCCTCCCT GGATACTTCT CCAGCTCAGG TCACCACCTC CCTTGCTCTC
TTCTTGATTC ATCTTGCCCT CAAAGTTTCC TGCTTTGTTT GATCATATCT GTGTGTTTTG TCCTATGCTT TACATTTCTG
GTGGATTTTC ATTTCTCAGG TTTGCAGGGG AACACGAGCA CTGCTGCTGA TGGAGCCAAG GGAAACGATG GGTTCAAGGC
AAGGTGATGA AAATTTTCTG GTTTTTTTTT TGGGAGCAGT CTGTTTGCTC GCAACAACAT TTTTCTGACG AATCTGCAGC
AAAAAGATGC TAAAATTTGC CCCTAAATTC TCTGCGATTC GCAGCAGGCC GGCGGCTCCG GTGGTCGGGT GGCCGCCGGT
GCGGTCGTTC CGGCGGAACC TCGCCTCGTC GTCGTCGTCG TCGAAGCCGC CGCGTGGAGG CCGAGACGCC GCCGCCGCCG
CCACGGGAGG CAAGGTGGCC CGGTTCGTCA AGGTGAACAT GGACGGCGTC CCGATCGGCC GGAAGGTCGA CCTGGCGGCG
CACGGCGGCT ACGGCGAGCT CTCCGCCGCC GTCGACCGTC TCTTCCGCGG CCTCCTCGCC GGTAAACCCC ACCACCTCGA
CATTATATAT CATCGGAGTT TTCTATCTCG AGCTTTCTCT TGATGGTGTT TGCTCGCTTG CTTGCTCGCG TTGGCAGCTC
AAAGGGACCC AACCATGGCC ACCGCCGCCG CCGCCGCCGC TGCCGGCGAG AGCTGCACAG GAGAGGAGGA GGCGATCGCC
GGGCTCCTCG ACGGCGGCAG CGGCGAGTAC ACGCTCGTCT ACGAGGACGA CGAGGGCGAC CAGATGCTCG TCGGCGACGT
GCCATGGAAG TGAGTCCGAC ACACACACAC ACCATGAATG AATCTCTCGT CTTCTCCAAA GCTAATGGCG ACGAATTCTT
GATTGATTGC AGCATGTTCA TCGCCGCGGC GAGGAGGCTG CGCGTGCTCA GGAGCTCCGA CCTGAACGCC TCCACGGTCA
GCGAAATTTC TGGTTTTCTG CTCCTTTTTC TTGAGAAATT TGATCGATTC TGACCCGTGA TTTTTGTTCT TGATCTTGTT
TTTGCAGATA CGAGCAGGGA GCAGGAAGAG GGCAGCTGCC GAGTGATCTT GATCTTGTTT TTTTCATCGC CGGGAGCAGA
GCAGGAAGCA TATCTGCATA GTGATTATGA TAGCTCTCTG TTTTGTTTTT AATCCTTTTC TCTTCGCGTT CTTGGAAGAT
TTTTGTGTAC AAAAATGCGC AAGAAGCGTC TTTTTTTGGG GATCATGATG TTGTCGACTA CGACTAGGAC AAGATGTAAT
CGAGAATGGA AATTGTTAGT ACTATTAATT AGGATCAAGT TCATCTGTTC TTGC

Locus: Os05g0186900

Loading...

Locus: Os05g0186900

Loading...