Os05t0187500-01

Locus

Os05g0187500

Description

IQ calmodulin-binding motif family protein, Positive regulator of brassinosteroid signalling, Regulation of grain width and weight

RAP-DB Gene Symbol Synonym(s)

GW5, qSW5/GW5, GSE5

RAP-DB Gene Name Synonym(s)

GRAIN WIDTH 5

CGSNL Gene Symbol

GW5

CGSNL Gene Name

GRAIN WIDTH 5

Oryzabase Gene Symbol Synonym(s)

qSW5/GW5, GSE5

Oryzabase Gene Name Synonym(s)

GRAIN SIZE ON CHROMOSOME 5

Transcript Evidence

KT895078

Protein Evidence

A0A1D8GZC0

Literature

PMID: 28394310

PMID: 28366824

Note

Manual Curation

December 14, 2017

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Domain of unknown function DUF4005 (IPR025064)

IQ motif, EF-hand binding site (IPR000048)

Expression Databases

TENOR (Os05t0187500-00)

Others

Oryzabase (15162)

KEGG (Os05t0187500-00)

Transcript

1413 bp

>Os05t0187500-01 IQ calmodulin-binding motif family protein, Positive regulator of brassinosteroid signalling, Regulation of grain width and weight
ATGggcaaggcggcgcggtggttccgcaacatgtggggaggagggaggaaggagcagaag
ggcgaggcgccggcgagtggggggaagaggtggagcttcgggaagtcgtcgagggactcg
gcggaggccgcggcggctgctgctgcggcggcggcggaggcttccgggggcaatgcggcg
atcgccagggcggccgaggcggcgtggctcaggtcggtgtacgccgacacggagcgggaG
CAGAGCAAGCACGCCATCGCCGTCGCCGCGGCCACCGCGGCGGCGGCTGATGCCGCCGTG
GCGGCCGCTCAGGCCGCCGTCGCCGTCGTGCGGCTTACTAGCAAGGGCCGCTCGGCTCCC
GTCCTCGCCGCCACCGTCGCCGGCGACACGCGCAGCCTTGCCGCCGCCGCCGTCAGAATC
CAGACGGCATTCAGAGGCTTCCTGGCGAAGAAGGCGCTGCGAGCGCTCAAGGCGCTGGTG
AAGCTGCAGGCGCTGGTGCGCGGCTACCTCGTTCGCCGGCAGGCCGCCGCCACGCTGCAG
AGCATGCAGGCGCTCGTCCGCGCCCAGGCCACTGTCCGCGCCCACCGCAGTGGCGCCGGC
GCCGCCGCCAATCTCCCGCACCTCCACCACGCTCCCTTCTGGCCCCGCCGCTCGCTGCAG
GAGAGGTGCGCCGGCGACGACACGAGGAGCGAGCACGGTGTGGCGGCGTACAGCCGGCGG
CTGTCGGCGAGCATCGAGTCGTCGTCGTACGGGTACGACCGGAGCCCCAAGATCGTGGAG
GTGGACACCGGGAGGCCCAAGTCGCGGTCGTCGTCGTCGCGGCGGGCGAGCTCCCCGCTG
CTGCTCGACGCCGCTGGGTGCGCGAGCGGCGGCGAGGACTGGTGCGCCAACTCCATGTCG
TCGCCGCTCCCGTGCTACCTCCCCGGCGGCGCGCCGCCGCCCCGCATCGCCGTCCCGACG
TCGCGCCACTTCCCCGACTACGACTGGTGCGCGCTGGAGAAGGCCCGGCCGGCGACGGCG
CAGAGCACGCCGCGGTACGCGCACGCGCCGCCGACGCCGACCAAGAGCGTGTGCGGCGGC
GGCGGCGGCGGCGGCATCCACTCGTCGCCGCTCAACTGCCCGAACTACATGTCCAACACG
CAGTCGTTCGAGGCGAAGGTGCGTTCGCAGAGCGCGCCGAAGCAGCGGCCGGAGACCGGC
GGCGCCGGCGCCGGCGGCGGCCGGAAGCGGGTGCCGCTGAGCGAGGTGGTGGTGGTGGAG
TCCAGGGCGAGCTTGAGCGGCGTGGGCATGCAGCGCTCGTGCAACCGGGTGCAGGAGGCG
TTCAACTTCAAGACGGCCGTCGTCGGCCGCCTCGACCGCTCGTCGGAGTCCGGCGAGAAC
GACCGCCACGCGTTCTTGCAGAGGAGGTGGTGA

CDS

1413 bp

>Os05t0187500-01 IQ calmodulin-binding motif family protein, Positive regulator of brassinosteroid signalling, Regulation of grain width and weight
ATGggcaaggcggcgcggtggttccgcaacatgtggggaggagggaggaaggagcagaag
ggcgaggcgccggcgagtggggggaagaggtggagcttcgggaagtcgtcgagggactcg
gcggaggccgcggcggctgctgctgcggcggcggcggaggcttccgggggcaatgcggcg
atcgccagggcggccgaggcggcgtggctcaggtcggtgtacgccgacacggagcgggaG
CAGAGCAAGCACGCCATCGCCGTCGCCGCGGCCACCGCGGCGGCGGCTGATGCCGCCGTG
GCGGCCGCTCAGGCCGCCGTCGCCGTCGTGCGGCTTACTAGCAAGGGCCGCTCGGCTCCC
GTCCTCGCCGCCACCGTCGCCGGCGACACGCGCAGCCTTGCCGCCGCCGCCGTCAGAATC
CAGACGGCATTCAGAGGCTTCCTGGCGAAGAAGGCGCTGCGAGCGCTCAAGGCGCTGGTG
AAGCTGCAGGCGCTGGTGCGCGGCTACCTCGTTCGCCGGCAGGCCGCCGCCACGCTGCAG
AGCATGCAGGCGCTCGTCCGCGCCCAGGCCACTGTCCGCGCCCACCGCAGTGGCGCCGGC
GCCGCCGCCAATCTCCCGCACCTCCACCACGCTCCCTTCTGGCCCCGCCGCTCGCTGCAG
GAGAGGTGCGCCGGCGACGACACGAGGAGCGAGCACGGTGTGGCGGCGTACAGCCGGCGG
CTGTCGGCGAGCATCGAGTCGTCGTCGTACGGGTACGACCGGAGCCCCAAGATCGTGGAG
GTGGACACCGGGAGGCCCAAGTCGCGGTCGTCGTCGTCGCGGCGGGCGAGCTCCCCGCTG
CTGCTCGACGCCGCTGGGTGCGCGAGCGGCGGCGAGGACTGGTGCGCCAACTCCATGTCG
TCGCCGCTCCCGTGCTACCTCCCCGGCGGCGCGCCGCCGCCCCGCATCGCCGTCCCGACG
TCGCGCCACTTCCCCGACTACGACTGGTGCGCGCTGGAGAAGGCCCGGCCGGCGACGGCG
CAGAGCACGCCGCGGTACGCGCACGCGCCGCCGACGCCGACCAAGAGCGTGTGCGGCGGC
GGCGGCGGCGGCGGCATCCACTCGTCGCCGCTCAACTGCCCGAACTACATGTCCAACACG
CAGTCGTTCGAGGCGAAGGTGCGTTCGCAGAGCGCGCCGAAGCAGCGGCCGGAGACCGGC
GGCGCCGGCGCCGGCGGCGGCCGGAAGCGGGTGCCGCTGAGCGAGGTGGTGGTGGTGGAG
TCCAGGGCGAGCTTGAGCGGCGTGGGCATGCAGCGCTCGTGCAACCGGGTGCAGGAGGCG
TTCAACTTCAAGACGGCCGTCGTCGGCCGCCTCGACCGCTCGTCGGAGTCCGGCGAGAAC
GACCGCCACGCGTTCTTGCAGAGGAGGTGGTGA

Protein

471 aa

>Os05t0187500-01 IQ calmodulin-binding motif family protein, Positive regulator of brassinosteroid signalling, Regulation of grain width and weight
MGKAARWFRNMWGGGRKEQKGEAPASGGKRWSFGKSSRDSAEAAAAAAAAAAEASGGNAA
IARAAEAAWLRSVYADTEREQSKHAIAVAAATAAAADAAVAAAQAAVAVVRLTSKGRSAP
VLAATVAGDTRSLAAAAVRIQTAFRGFLAKKALRALKALVKLQALVRGYLVRRQAAATLQ
SMQALVRAQATVRAHRSGAGAAANLPHLHHAPFWPRRSLQERCAGDDTRSEHGVAAYSRR
LSASIESSSYGYDRSPKIVEVDTGRPKSRSSSSRRASSPLLLDAAGCASGGEDWCANSMS
SPLPCYLPGGAPPPRIAVPTSRHFPDYDWCALEKARPATAQSTPRYAHAPPTPTKSVCGG
GGGGGIHSSPLNCPNYMSNTQSFEAKVRSQSAPKQRPETGGAGAGGGRKRVPLSEVVVVE
SRASLSGVGMQRSCNRVQEAFNFKTAVVGRLDRSSESGENDRHAFLQRRW*

CDS

chr05:5365122..5365565 (+ strand) : 444 bp

chr05:5365652..5365864 (+ strand) : 213 bp

chr05:5365946..5366701 (+ strand) : 756 bp

FASTA

>Os05t0187500-01 class=Sequence position=chr05:5365122..5366701 (+ strand)
ATGggcaagg cggcgcggtg gttccgcaac atgtggggag gagggaggaa ggagcagaag ggcgaggcgc cggcgagtgg
ggggaagagg tggagcttcg ggaagtcgtc gagggactcg gcggaggccg cggcggctgc tgctgcggcg gcggcggagg
cttccggggg caatgcggcg atcgccaggg cggccgaggc ggcgtggctc aggtcggtgt acgccgacac ggagcgggaG
CAGAGCAAGC ACGCCATCGC CGTCGCCGCG GCCACCGCGG CGGCGGCTGA TGCCGCCGTG GCGGCCGCTC AGGCCGCCGT
CGCCGTCGTG CGGCTTACTA GCAAGGGCCG CTCGGCTCCC GTCCTCGCCG CCACCGTCGC CGGCGACACG CGCAGCCTTG
CCGCCGCCGC CGTCAGAATC CAGACGGCAT TCAGAGGCTT CCTGGTAAGC AACGGGTGCT CGTCTTCTTG CTCTGGTTTC
GTCGTCGTCG TCGTCGCCAT TGTCGTTAAT CATGGCGTGT GTTCGTGCAG GCGAAGAAGG CGCTGCGAGC GCTCAAGGCG
CTGGTGAAGC TGCAGGCGCT GGTGCGCGGC TACCTCGTTC GCCGGCAGGC CGCCGCCACG CTGCAGAGCA TGCAGGCGCT
CGTCCGCGCC CAGGCCACTG TCCGCGCCCA CCGCAGTGGC GCCGGCGCCG CCGCCAATCT CCCGCACCTC CACCACGCTC
CCTTCTGGCC CCGCCGCTCG CTGGTACGCC GCTGGCTAAA TCTCGCCGAC GACATCGCCA TGTATATGTT CGATGTTGAC
GTTGTGTGTT GGCGATGGAT GCAGCAGGAG AGGTGCGCCG GCGACGACAC GAGGAGCGAG CACGGTGTGG CGGCGTACAG
CCGGCGGCTG TCGGCGAGCA TCGAGTCGTC GTCGTACGGG TACGACCGGA GCCCCAAGAT CGTGGAGGTG GACACCGGGA
GGCCCAAGTC GCGGTCGTCG TCGTCGCGGC GGGCGAGCTC CCCGCTGCTG CTCGACGCCG CTGGGTGCGC GAGCGGCGGC
GAGGACTGGT GCGCCAACTC CATGTCGTCG CCGCTCCCGT GCTACCTCCC CGGCGGCGCG CCGCCGCCCC GCATCGCCGT
CCCGACGTCG CGCCACTTCC CCGACTACGA CTGGTGCGCG CTGGAGAAGG CCCGGCCGGC GACGGCGCAG AGCACGCCGC
GGTACGCGCA CGCGCCGCCG ACGCCGACCA AGAGCGTGTG CGGCGGCGGC GGCGGCGGCG GCATCCACTC GTCGCCGCTC
AACTGCCCGA ACTACATGTC CAACACGCAG TCGTTCGAGG CGAAGGTGCG TTCGCAGAGC GCGCCGAAGC AGCGGCCGGA
GACCGGCGGC GCCGGCGCCG GCGGCGGCCG GAAGCGGGTG CCGCTGAGCG AGGTGGTGGT GGTGGAGTCC AGGGCGAGCT
TGAGCGGCGT GGGCATGCAG CGCTCGTGCA ACCGGGTGCA GGAGGCGTTC AACTTCAAGA CGGCCGTCGT CGGCCGCCTC
GACCGCTCGT CGGAGTCCGG CGAGAACGAC CGCCACGCGT TCTTGCAGAG GAGGTGGTGA