Os05t0196600-00

Locus

Os05g0196600

Description

Similar to 1-aminocyclopropane-1-carboxylic acid synthase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ACS3

CGSNL Gene Name

ACC SYNTHASE 3

Oryzabase Gene Symbol Synonym(s)

ACC3*, ACC3, OsACS3, OS-ACS3

Oryzabase Gene Name Synonym(s)

ACC synthase 3, ACC synthase-3, 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 3, 1-aminocyclopropane-1-carboxylic acid synthase 3

Transcript Evidence

Y15739 (DDBJ)

Protein Evidence

O24220 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: biosynthetic process (GO:0009058)

Biological Process: 1-aminocyclopropane-1-carboxylate biosynthetic process (GO:0042218)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: transferase activity, transferring nitrogenous groups (GO:0016769)

Molecular Function: 1-aminocyclopropane-1-carboxylate synthase activity (GO:0016847)

Molecular Function: pyridoxal phosphate binding (GO:0030170)

Functional domain (InterPro)

1-aminocyclopropane-1-carboxylate synthase (IPR001176)

Aminotransferases, class-I, pyridoxal-phosphate-binding site (IPR004838)

Aminotransferase, class I/classII (IPR004839)

Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (IPR015422)

Pyridoxal phosphate-dependent transferase, major domain (IPR015424)

Expression Databases

TENOR (Os05t0196600-00)

Others

Oryzabase (635)

KEGG (Os05t0196600-00)

Transcript

1359 bp

>Os05t0196600-00 Similar to 1-aminocyclopropane-1-carboxylic acid synthase.
ATGGTTGGCAGGATGCTTTCTTCCCCAGAGCCTACACTGTCAACCATGGCGATGTCGGCG
GCTCACGGCGAGGACTCGCCGTACTTTGCAGGGTGGAGAGCCTATGATGAGGACCCCTAT
GACCCCATCACCAATCCTCAAGGTGTCATACAGATGGGCCTTGCAGAAAACCAGGTTTCC
TTTGATCTTCTAGAGGAATACATGAGGGAGCACCCGGAGGCGTCGGATTGCGGCGCCGGG
GTTCGAGAGAACGCCCTGTTCCAGGACTACCATGGCCTGAAATCATTCAGGAAGGCAATG
GCGAGCTTCATGGAGACGATAAGGGGAGGCAAGGCGAGGTTCGACCCGGACCGCGTCGTC
CTCACCGCCGGCGCCACCGCCGCCAACGAGCTTCTCACCTTCATCCTCGCCGACCCCGGC
GACGCCCTCCTCGTCCCTACCCCTTACTACCCAGGGTTTGACAGGGACTTGAGGTGGAGG
ACCGGCGTGAACATCGTCCCGGTGAGCTGCGACAGCGCCGCCGGGTTCCAGGTCACCGCC
GGCGCGCTCCGGGCCGCGTACGACGAGGCCGTGGCGGCGGGGACGCGCGTCCGCGGCGTG
CTCATCACGAACCCGTCGAACCCGCTCGGCACGACGGCGGCGCGTGGCGTCCTCGAGGGC
ATCCTCGACTTcgtggcgcgccacgacatgcacctcatctccgacgagatctactccggc
tccgtgttcgccgcgccggacctggtcagcgtcgcggagctcgtcgacgagcgccgccgc
gcgcgcggcggcgccgccgacgccgaggacatcgcccggcgcgtccacgtcgtgtacagc
ctctccaaggacctgggcctcccggggttccgcgtcggcgtgGTCTACTCCTACAACGAC
GCCGTGGTGGCCGCGGCGAGGCGCATGTCGAGCTTCACGCTGGTGTCGTCGCAGACGCAG
CGGACGCTCGCCGCGATGCTGTCCGACGCGGCGTTCGCGGCGGCGTACGTGCGCTCCAAC
CGCGACCGCCTCCGGGAGCGGCACGCGCGCGCGGTGGCCGGGCTGCGGCGCGCCGGCGTG
GCGTGCCTCCGAGGCGCCAACGCCGGGCTGTTCGTGTGGGTGGACATGCGCCGCCTGCTG
GGCGACGGCGAGGCCACCGTCGCCGGCGAGCTGAGGCTGTGGCGGCGCGTGGTCGCCGAG
GCGAAGCTGAACATCTCGCCGGGGTCGTCGTGCCATTGCCGGGAGCCGGGGTGGTTCAGG
GTGTGCTTCGCCAACATGAGCTTGGAGACGCTGGACGTTGCACTCCATAGACTGGGCTGC
TTCATCAAGAAATGGGAGCAAGAACAACATGAGAATTAA

CDS

1359 bp

>Os05t0196600-00 Similar to 1-aminocyclopropane-1-carboxylic acid synthase.
ATGGTTGGCAGGATGCTTTCTTCCCCAGAGCCTACACTGTCAACCATGGCGATGTCGGCG
GCTCACGGCGAGGACTCGCCGTACTTTGCAGGGTGGAGAGCCTATGATGAGGACCCCTAT
GACCCCATCACCAATCCTCAAGGTGTCATACAGATGGGCCTTGCAGAAAACCAGGTTTCC
TTTGATCTTCTAGAGGAATACATGAGGGAGCACCCGGAGGCGTCGGATTGCGGCGCCGGG
GTTCGAGAGAACGCCCTGTTCCAGGACTACCATGGCCTGAAATCATTCAGGAAGGCAATG
GCGAGCTTCATGGAGACGATAAGGGGAGGCAAGGCGAGGTTCGACCCGGACCGCGTCGTC
CTCACCGCCGGCGCCACCGCCGCCAACGAGCTTCTCACCTTCATCCTCGCCGACCCCGGC
GACGCCCTCCTCGTCCCTACCCCTTACTACCCAGGGTTTGACAGGGACTTGAGGTGGAGG
ACCGGCGTGAACATCGTCCCGGTGAGCTGCGACAGCGCCGCCGGGTTCCAGGTCACCGCC
GGCGCGCTCCGGGCCGCGTACGACGAGGCCGTGGCGGCGGGGACGCGCGTCCGCGGCGTG
CTCATCACGAACCCGTCGAACCCGCTCGGCACGACGGCGGCGCGTGGCGTCCTCGAGGGC
ATCCTCGACTTcgtggcgcgccacgacatgcacctcatctccgacgagatctactccggc
tccgtgttcgccgcgccggacctggtcagcgtcgcggagctcgtcgacgagcgccgccgc
gcgcgcggcggcgccgccgacgccgaggacatcgcccggcgcgtccacgtcgtgtacagc
ctctccaaggacctgggcctcccggggttccgcgtcggcgtgGTCTACTCCTACAACGAC
GCCGTGGTGGCCGCGGCGAGGCGCATGTCGAGCTTCACGCTGGTGTCGTCGCAGACGCAG
CGGACGCTCGCCGCGATGCTGTCCGACGCGGCGTTCGCGGCGGCGTACGTGCGCTCCAAC
CGCGACCGCCTCCGGGAGCGGCACGCGCGCGCGGTGGCCGGGCTGCGGCGCGCCGGCGTG
GCGTGCCTCCGAGGCGCCAACGCCGGGCTGTTCGTGTGGGTGGACATGCGCCGCCTGCTG
GGCGACGGCGAGGCCACCGTCGCCGGCGAGCTGAGGCTGTGGCGGCGCGTGGTCGCCGAG
GCGAAGCTGAACATCTCGCCGGGGTCGTCGTGCCATTGCCGGGAGCCGGGGTGGTTCAGG
GTGTGCTTCGCCAACATGAGCTTGGAGACGCTGGACGTTGCACTCCATAGACTGGGCTGC
TTCATCAAGAAATGGGAGCAAGAACAACATGAGAATTAA

Protein

453 aa

>Os05t0196600-00 Similar to 1-aminocyclopropane-1-carboxylic acid synthase.
MVGRMLSSPEPTLSTMAMSAAHGEDSPYFAGWRAYDEDPYDPITNPQGVIQMGLAENQVS
FDLLEEYMREHPEASDCGAGVRENALFQDYHGLKSFRKAMASFMETIRGGKARFDPDRVV
LTAGATAANELLTFILADPGDALLVPTPYYPGFDRDLRWRTGVNIVPVSCDSAAGFQVTA
GALRAAYDEAVAAGTRVRGVLITNPSNPLGTTAARGVLEGILDFVARHDMHLISDEIYSG
SVFAAPDLVSVAELVDERRRARGGAADAEDIARRVHVVYSLSKDLGLPGFRVGVVYSYND
AVVAAARRMSSFTLVSSQTQRTLAAMLSDAAFAAAYVRSNRDRLRERHARAVAGLRRAGV
ACLRGANAGLFVWVDMRRLLGDGEATVAGELRLWRRVVAEAKLNISPGSSCHCREPGWFR
VCFANMSLETLDVALHRLGCFIKKWEQEQHEN*

CDS

chr05:5956118..5956291 (- strand) : 174 bp

chr05:5955874..5955993 (- strand) : 120 bp

chr05:5955595..5955755 (- strand) : 161 bp

chr05:5954551..5955454 (- strand) : 904 bp

FASTA

>Os05t0196600-00 class=Sequence position=chr05:5954551..5956291 (- strand)
ATGGTTGGCA GGATGCTTTC TTCCCCAGAG CCTACACTGT CAACCATGGC GATGTCGGCG GCTCACGGCG AGGACTCGCC
GTACTTTGCA GGGTGGAGAG CCTATGATGA GGACCCCTAT GACCCCATCA CCAATCCTCA AGGTGTCATA CAGATGGGCC
TTGCAGAAAA CCAGGTGATC TTAGTTGCTA AAATCTTAAT TGTTCTTACT TCAAACTAAT CGAAAACGCG TTAATGCGTT
ATATATATCA TGTGTATCGA TCGTTAAGAC GCAAGAACTT TTACGTTTCC TGTGTTAGGT TTCCTTTGAT CTTCTAGAGG
AATACATGAG GGAGCACCCG GAGGCGTCGG ATTGCGGCGC CGGGGTTCGA GAGAACGCCC TGTTCCAGGA CTACCATGGC
CTGAAATCAT TCAGGAAGGT AAATTGATTG AGATCAAAGG CATGAAATCA TGTGTTTGTG TCTTGGTTTT CTTGATCGTT
GAGAATACTA CATGTTGCTG AAGTTTGATG GTTGCTTGTG ATGATGCATT GGGTAGGCAA TGGCGAGCTT CATGGAGACG
ATAAGGGGAG GCAAGGCGAG GTTCGACCCG GACCGCGTCG TCCTCACCGC CGGCGCCACC GCCGCCAACG AGCTTCTCAC
CTTCATCCTC GCCGACCCCG GCGACGCCCT CCTCGTCCCT ACCCCTTACT ACCCAGGGTA ATGCAAGTGT AGCTCGTGAT
GTACACAAGC TGTTCGATCG ATCGATCGAT CGATCGCCAT GGCTAGCTGT AGCTTTGAGC TGTGTCGTGT CGTGTCGTGT
CGTCGTCTTG ACATGCGTTC ATGTCGCGTT CGTGCAGGTT TGACAGGGAC TTGAGGTGGA GGACCGGCGT GAACATCGTC
CCGGTGAGCT GCGACAGCGC CGCCGGGTTC CAGGTCACCG CCGGCGCGCT CCGGGCCGCG TACGACGAGG CCGTGGCGGC
GGGGACGCGC GTCCGCGGCG TGCTCATCAC GAACCCGTCG AACCCGCTCG GCACGACGGC GGCGCGTGGC GTCCTCGAGG
GCATCCTCGA CTTcgtggcg cgccacgaca tgcacctcat ctccgacgag atctactccg gctccgtgtt cgccgcgccg
gacctggtca gcgtcgcgga gctcgtcgac gagcgccgcc gcgcgcgcgg cggcgccgcc gacgccgagg acatcgcccg
gcgcgtccac gtcgtgtaca gcctctccaa ggacctgggc ctcccggggt tccgcgtcgg cgtgGTCTAC TCCTACAACG
ACGCCGTGGT GGCCGCGGCG AGGCGCATGT CGAGCTTCAC GCTGGTGTCG TCGCAGACGC AGCGGACGCT CGCCGCGATG
CTGTCCGACG CGGCGTTCGC GGCGGCGTAC GTGCGCTCCA ACCGCGACCG CCTCCGGGAG CGGCACGCGC GCGCGGTGGC
CGGGCTGCGG CGCGCCGGCG TGGCGTGCCT CCGAGGCGCC AACGCCGGGC TGTTCGTGTG GGTGGACATG CGCCGCCTGC
TGGGCGACGG CGAGGCCACC GTCGCCGGCG AGCTGAGGCT GTGGCGGCGC GTGGTCGCCG AGGCGAAGCT GAACATCTCG
CCGGGGTCGT CGTGCCATTG CCGGGAGCCG GGGTGGTTCA GGGTGTGCTT CGCCAACATG AGCTTGGAGA CGCTGGACGT
TGCACTCCAT AGACTGGGCT GCTTCATCAA GAAATGGGAG CAAGAACAAC ATGAGAATTA A