Os05t0207500-01

Locus

Os05g0207500

Description

GSK3/SHAGGY-like kinase, Brassinosteroid signaling

RAP-DB Gene Symbol Synonym(s)

GSK2, Os GSK2, OsGSK2, Os BIN2, OsBIN2

RAP-DB Gene Name Synonym(s)

GSK3/SHAGGY-Like Kinase 2, GSK3/SHAGGY-LIKE KINASE2

CGSNL Gene Symbol

BIN2

CGSNL Gene Name

BRASSINOSTEROID-INSENSITIVE 2

Oryzabase Gene Symbol Synonym(s)

GSK2, Os GSK2, OsGSK2, Os BIN2, OsBIN2, BIN2/GSK2, OsSK22/OsGSK7, OsSK22, OsGSK7, SK22, GSK7, OsSK22/GSK2

Oryzabase Gene Name Synonym(s)

GSK3/SHAGGY-Like Kinase 2, GSK3/SHAGGY-LIKE KINASE2, BRASSINOSTEROID-INSENSITIVE2, GSK3/SHAGGY-Like Kinase 22, GSK3-like Kinase 7, Shaggy/GSK3-like kinase 22

Transcript Evidence

AK102147

Protein Evidence

Q60EZ2

Literature

PMID: 22685166

Note

Manual Curation

September 2, 2014

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase-like domain (IPR011009)

Protein kinase domain (IPR000719)

Serine/threonine/dual specificity protein kinase, catalytic domain (IPR002290)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase, active site (IPR008271)

Full-length cDNA

J033086C10 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0207500-01)

Others

Oryzabase (10942)

KEGG (Os05t0207500-01 (EC:2.7.11.26))

Transcript

1863 bp

>Os05t0207500-01 GSK3/SHAGGY-like kinase, Brassinosteroid signaling
ATCCCTCCCAGTATAAGCCAAACCAATCCATAGAGGAGGAAGAGGAGGACCAGGTGGTGG
CACACCTAAGCTTTGTGCAGTGCCATTCACGCACCTGCAGCTTCCAGCTTTGCCACATGG
ACCAGCCGGCGCCGGCGCCGGAGCCGATGCTGCTCGACGCGCAGCCGCCCGCCGCCGTCG
CCTGCGACAAGAAGCAGCAGGAGGGGGaggcgccgtacgcggaggggaatgacgcggtga
ccgggcacatcatctccaccaccatcgggggcaagaacggcgagcccaagaggACAATTA
GCTACATGGCGGAGCGCGTTGTGGGCACTGGTTCTTTCGGTATCGTCTTTCAGGCTAAAT
GCTTGGAGACAGGAGAGACTGTTGCCATTAAGAAGGTATTGCAGGACCGACGGTACAAGA
ACCGTGAGCTTCAGCTTATGCGCGCCATGGACCACCCCAATGTCATCTCCCTGAAGCATT
GCTTCTTCTCAACCACAAGTAGGGATGAGCTGTTCCTCAATCTTGTCATGGAATATGTTC
CAGAAACACTCTACCGTGTGCTTAAGCACTACAGCAATGCCAACCACCGGATGCCACTTA
TCTACGTCAAGCTTTACATGTATCAGTTATTTAGGGGGCTTGCGTACATTCATACTGTTC
CAGGGGTCTGTCATAGGGATGTGAAGCCACAAAATGTTTTGGTGGATCCTCTAACTCATC
AAGTCAAGCTCTGTGACTTTGGGAGCGCAAAAACACTGGTCCCAGGTGAACCCAATATAT
CATATATATGCTCACGCTACTACCGAGCACCGGAGCTCATATTTGGTGCAACTGAATATA
CTACATCAATAGATATATGGTCAGCTGGGTGTGTTCTTGCAGAGCTACTCCTTGGTCAGC
CATTGTTTCCAGGGGAGAGTGCAGTCGATCAGCTTGTAGAGATAATTAAGGTTCTTGGTA
CACCAACCCGTGAGGAAATACGTTGCATGAACCCGAACTATACAGAGTTTAGGTTTCCAC
AGATAAAAGCTCACCCTTGGCACAAGGTTTTCCACAAGAGGATGCCTCCTGAAGCAATAG
ACCTCGCTTCACGCCTTCTTCAATATTCACCGAGTCTCCGCTGCACTGCTCTTGATGCAT
GTGCACATCCTTTCTTTGATGAGCTGCGAGAGCCGAATGCACGCTTGCCAAACGGACGTC
CATTTCCACCACTATTCAACTTCAAACACGAACTAGCAAATTCTTCTCAAGAGCTCATCA
GCAGGCTCATACCAGAACATGTTCGACGGCAAGCTACCCACAACTTCTTCAATACTGGGA
GCTAAAAATGCTAAATGCACACCACCAGACCTTTTGTTGGATCGTTTTCGCGGAACCGGT
GAAGTTCACATGAAGGCTGAGTCAGATGATTCTTCGAATCCCCGCAAAACAAGAAGAATA
GAAAATATGATTCCTCAGATGATGATATGCAAATGCTTCGTTGGAAGTTCAATTCAATCA
TCGAAGAAGAACAACATTGTAAATCGAGAAGTTTTTGCATCGCGAGTTTGGTAGTGAAAC
CGGGATCAGCTGGTATGACGGAGGAAACCGAAATGTTTAGATCCATGACTGAGTTTTCTT
TCATTTTTTTTGCCCAATTGTAACAGAAGAATATAGTTCCCTAATGTAGGCGTAGTTGTA
ACCTGTAAACTGCCACTGTTTTGTTCACATTCCATGATGTAAATGCCACCATGCCTCTGA
TGAATAACTCTCCTTGTAACCTTGTTCCTTCCATCCTTGACTGTTTACCTTAAAGCCGTG
GACAGTGTACACTGTACATGTACCGTGCTACACGGAAGGACATATTTGAATTTTTTTTCT
CTC

CDS

1209 bp

>Os05t0207500-01 GSK3/SHAGGY-like kinase, Brassinosteroid signaling
ATGGACCAGCCGGCGCCGGCGCCGGAGCCGATGCTGCTCGACGCGCAGCCGCCCGCCGCC
GTCGCCTGCGACAAGAAGCAGCAGGAGGGGGaggcgccgtacgcggaggggaatgacgcg
gtgaccgggcacatcatctccaccaccatcgggggcaagaacggcgagcccaagaggACA
ATTAGCTACATGGCGGAGCGCGTTGTGGGCACTGGTTCTTTCGGTATCGTCTTTCAGGCT
AAATGCTTGGAGACAGGAGAGACTGTTGCCATTAAGAAGGTATTGCAGGACCGACGGTAC
AAGAACCGTGAGCTTCAGCTTATGCGCGCCATGGACCACCCCAATGTCATCTCCCTGAAG
CATTGCTTCTTCTCAACCACAAGTAGGGATGAGCTGTTCCTCAATCTTGTCATGGAATAT
GTTCCAGAAACACTCTACCGTGTGCTTAAGCACTACAGCAATGCCAACCACCGGATGCCA
CTTATCTACGTCAAGCTTTACATGTATCAGTTATTTAGGGGGCTTGCGTACATTCATACT
GTTCCAGGGGTCTGTCATAGGGATGTGAAGCCACAAAATGTTTTGGTGGATCCTCTAACT
CATCAAGTCAAGCTCTGTGACTTTGGGAGCGCAAAAACACTGGTCCCAGGTGAACCCAAT
ATATCATATATATGCTCACGCTACTACCGAGCACCGGAGCTCATATTTGGTGCAACTGAA
TATACTACATCAATAGATATATGGTCAGCTGGGTGTGTTCTTGCAGAGCTACTCCTTGGT
CAGCCATTGTTTCCAGGGGAGAGTGCAGTCGATCAGCTTGTAGAGATAATTAAGGTTCTT
GGTACACCAACCCGTGAGGAAATACGTTGCATGAACCCGAACTATACAGAGTTTAGGTTT
CCACAGATAAAAGCTCACCCTTGGCACAAGGTTTTCCACAAGAGGATGCCTCCTGAAGCA
ATAGACCTCGCTTCACGCCTTCTTCAATATTCACCGAGTCTCCGCTGCACTGCTCTTGAT
GCATGTGCACATCCTTTCTTTGATGAGCTGCGAGAGCCGAATGCACGCTTGCCAAACGGA
CGTCCATTTCCACCACTATTCAACTTCAAACACGAACTAGCAAATTCTTCTCAAGAGCTC
ATCAGCAGGCTCATACCAGAACATGTTCGACGGCAAGCTACCCACAACTTCTTCAATACT
GGGAGCTAA

Protein

403 aa

>Os05t0207500-01 GSK3/SHAGGY-like kinase, Brassinosteroid signaling
MDQPAPAPEPMLLDAQPPAAVACDKKQQEGEAPYAEGNDAVTGHIISTTIGGKNGEPKRT
ISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDRRYKNRELQLMRAMDHPNVISLK
HCFFSTTSRDELFLNLVMEYVPETLYRVLKHYSNANHRMPLIYVKLYMYQLFRGLAYIHT
VPGVCHRDVKPQNVLVDPLTHQVKLCDFGSAKTLVPGEPNISYICSRYYRAPELIFGATE
YTTSIDIWSAGCVLAELLLGQPLFPGESAVDQLVEIIKVLGTPTREEIRCMNPNYTEFRF
PQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALDACAHPFFDELREPNARLPNG
RPFPPLFNFKHELANSSQELISRLIPEHVRRQATHNFFNTGS*

5'UTR

chr05:6661378..6661493 (- strand) : 116 bp

CDS

chr05:6661303..6661377 (- strand) : 75 bp

chr05:6661110..6661211 (- strand) : 102 bp

chr05:6660615..6660674 (- strand) : 60 bp

chr05:6660249..6660521 (- strand) : 273 bp

chr05:6660089..6660163 (- strand) : 75 bp

chr05:6659951..6660007 (- strand) : 57 bp

chr05:6659463..6659603 (- strand) : 141 bp

chr05:6659299..6659349 (- strand) : 51 bp

chr05:6659116..6659211 (- strand) : 96 bp

chr05:6658848..6658931 (- strand) : 84 bp

chr05:6658223..6658324 (- strand) : 102 bp

chr05:6658019..6658111 (- strand) : 93 bp

3'UTR

chr05:6657481..6658018 (- strand) : 538 bp

FASTA

>Os05t0207500-01 class=Sequence position=chr05:6657481..6661493 (- strand)
ATCCCTCCCA GTATAAGCCA AACCAATCCA TAGAGGAGGA AGAGGAGGAC CAGGTGGTGG CACACCTAAG CTTTGTGCAG
TGCCATTCAC GCACCTGCAG CTTCCAGCTT TGCCACATGG ACCAGCCGGC GCCGGCGCCG GAGCCGATGC TGCTCGACGC
GCAGCCGCCC GCCGCCGTCG CCTGCGACAA GGTATGTGAC TAACCGGATC TTGGCGTGCT GATCCGTGGT TTTGCGGTTC
TTTGCTGTGT GCTGATTTAG TGTGCTGTTC TTGGTGGAGC AGAAGCAGCA GGAGGGGGag gcgccgtacg cggaggggaa
tgacgcggtg accgggcaca tcatctccac caccatcggg ggcaagaacg gcgagcccaa gagggtgagA CACGAGCCTT
CCCCCCCCCC CCTTTGTTGT TTTGGTCTTG GTTCCATTTC TTGAGTTGCA GTGAAATGCT GCCGGTTCTT GGTTTAGGAA
GGTGTTCTTG TGTGTTCTGC AGCTAGTTTC TTAGCTCCGT GTAGTGATTT TTGGTGATGG GAAAGCCATT GGCTCTAAGA
GAGGCATGTG GATTAGTGGT CAGATTTTGC AAAAGAAGTA AACTGTTGGT AGATATCAGC CAATTTATTT AGTGTTAGTT
GTTCATGTTC TTGTATTACT GCAAGATCTG TTGTAAATAA CTAAATATGG CTTGTTTGGT GCTCATTTTT GGTGGTTTGT
AGGGGAAAAA GTTGGGTGTG TTGGATTACA TTGTTGTGAA CACTAGTGCT CATAATTAAA TTTTGGTCTT AAGATGGTAA
TTTTGTACTT GATTTTCAGA CAATTAGCTA CATGGCGGAG CGCGTTGTGG GCACTGGTTC TTTCGGTATC GTCTTTCAGG
TGATTCATCT TTCAGAAAGT TGTTATTTGT TTCTTTCTTT TCGTGCTGTC GACTTGTTGG TCTGATGTTT AGCTTGCTGG
TTTCATGTGT AGGCTAAATG CTTGGAGACA GGAGAGACTG TTGCCATTAA GAAGGTATTG CAGGACCGAC GGTACAAGAA
CCGTGAGCTT CAGCTTATGC GCGCCATGGA CCACCCCAAT GTCATCTCCC TGAAGCATTG CTTCTTCTCA ACCACAAGTA
GGGATGAGCT GTTCCTCAAT CTTGTCATGG AATATGTTCC AGAAACACTC TACCGTGTGC TTAAGCACTA CAGCAATGCC
AACCACCGGA TGCCACTTAT CTACGTCAAG CTTTACATGT ATCAGGTGTG TGGATTGCTA ATCAATCATA AATTTTGAAA
TGCCTGCCTT CCTGTGTGTC TCTTCTAAGT CTATTCTACA TTGGCTGCAG TTATTTAGGG GGCTTGCGTA CATTCATACT
GTTCCAGGGG TCTGTCATAG GGATGTGAAG CCACAAAATG TTTTGGTAGG TATTCATGAT CAGATTATTA TTTTGCTATG
CGATGGCCTT TGATTATTGG CTCTGAACTC CTTTCTTGCA ATACAGGTGG ATCCTCTAAC TCATCAAGTC AAGCTCTGTG
ACTTTGGGAG CGCAAAAACA CTGGTATTGG CCTTTTCCAC CCTAAAGTTT TGTAATACGC ACACATTACT TTAGACTTTC
TTTTTTTTAA TTGGACTTTA GACGATTCTT GCTGTAGACT AGTCAGTTTT GAATCTTACC ATTTGTTAAG TTGGAGCTAG
CCCTGTGTTA CTGAATCGTT CAAAGAACTC TTATATACTT GGTGAATCTT ACCCCTTTTT TTCTTCCTTT TTATTATGCT
TGATGGAAGT TTCATGGAAA TTCCTTAGTT TTACACCTTT TTCCACCTTA TTCCAGATGT TTGCTACAAT TGTACTTTTG
ATAATTTTGA TCTTACTGTC CTAATATCCA TTAATTTACT ATTCCATCAG GTCCCAGGTG AACCCAATAT ATCATATATA
TGCTCACGCT ACTACCGAGC ACCGGAGCTC ATATTTGGTG CAACTGAATA TACTACATCA ATAGATATAT GGTCAGCTGG
GTGTGTTCTT GCAGAGCTAC TCCTTGGTCA GGTTGGTTTC TTTTTTCTAT GGTTGACAGA TCTGCAAACT TTTGGTTTAG
TTATTTAAGC ATGATGTCAT CACTGTTGCT GTGATTTTGA TTATCTTGTA TTTGTTTTTG CTAGCCATTG TTTCCAGGGG
AGAGTGCAGT CGATCAGCTT GTAGAGATAA TTAAGGTACT GCAAGACATG CCATGCAGTT CTAATTTTGC TCCTACTATT
GAGTATGGGC ATCTTCTCTA ACCTTGTATG ATATTCTTGC AGGTTCTTGG TACACCAACC CGTGAGGAAA TACGTTGCAT
GAACCCGAAC TATACAGAGT TTAGGTTTCC ACAGATAAAA GCTCACCCTT GGCACAAGGT AAGCATACAA TCTTATCCAT
GTTGAGTCAT ATATCACGTC ATCTTTTATA GTTTCCTGGA CAACTATGAA AATGTAGCTG GGCTCATTTC CAATAATAGA
TTCTGGACAC CAGATAGCTT TACAATGCAA TGTATAAATA AGGAGGTGCA TACAGGTACT GATTTTTCTA ACTTCTGCGT
AGGTTTTCCA CAAGAGGATG CCTCCTGAAG CAATAGACCT CGCTTCACGC CTTCTTCAAT ATTCACCGAG TCTCCGCTGC
ACTGCTGTGA GTATATTCTT GCTGCAATTT TAAGTAGCAG AACAGTAGAA AAGTGATTTT TCACTACTGC TCACAGCAGG
GGTACTGTAA AACGCCCCTT TTCTTATTGC TGTTATGCAA GTTTGCCTAC TGTAGCTGGT CATATGAGCT GTTACTTTTC
ACCCTTTAAG AGTTGCACAA ATTTGAGCGT AACCAAGGAA TTTTCTTAAT CACTTTGCCC TCCAAGTGCT CTTTGATTTG
TGCAACTCCT GAAATGGGGT GGAGTGGAGA AACACTCCTT GTTTCTTTCT CTTTTTTCTT TTTTCCTAAA GTAGATTGAA
GAATGCTAGT CTTCACTAAC TTTGGTTTTA GTGGGGCATG GCCATTATGG TTATGATCTT TAGTGGTCCA TTACCAAATC
AATGTTGGGG TGGATGAATG ATAGTTGTCT CATGTTTAGT CGTTATTCAG TGTAATTGCA ATAGCCAGAT GACAACTTAA
TATTGATTTT TTTTCCGATG TGCTTATTCA TTTGAATATC TTTATGCAGC TTGATGCATG TGCACATCCT TTCTTTGATG
AGCTGCGAGA GCCGAATGCA CGCTTGCCAA ACGGACGTCC ATTTCCACCA CTATTCAACT TCAAACACGA AGTAAGTGAA
TCAGATGAAA CATAATCTGC TACACAACTT CAGATCTTGG TATCCATGAG AAAATGTGTA CTCTCCTTGG TGCTCATTGG
TGCTGCCTTT TGGTCTCTAC AGCTAGCAAA TTCTTCTCAA GAGCTCATCA GCAGGCTCAT ACCAGAACAT GTTCGACGGC
AAGCTACCCA CAACTTCTTC AATACTGGGA GCTAAAAATG CTAAATGCAC ACCACCAGAC CTTTTGTTGG ATCGTTTTCG
CGGAACCGGT GAAGTTCACA TGAAGGCTGA GTCAGATGAT TCTTCGAATC CCCGCAAAAC AAGAAGAATA GAAAATATGA
TTCCTCAGAT GATGATATGC AAATGCTTCG TTGGAAGTTC AATTCAATCA TCGAAGAAGA ACAACATTGT AAATCGAGAA
GTTTTTGCAT CGCGAGTTTG GTAGTGAAAC CGGGATCAGC TGGTATGACG GAGGAAACCG AAATGTTTAG ATCCATGACT
GAGTTTTCTT TCATTTTTTT TGCCCAATTG TAACAGAAGA ATATAGTTCC CTAATGTAGG CGTAGTTGTA ACCTGTAAAC
TGCCACTGTT TTGTTCACAT TCCATGATGT AAATGCCACC ATGCCTCTGA TGAATAACTC TCCTTGTAAC CTTGTTCCTT
CCATCCTTGA CTGTTTACCT TAAAGCCGTG GACAGTGTAC ACTGTACATG TACCGTGCTA CACGGAAGGA CATATTTGAA
TTTTTTTTCT CTC