Os05t0211100-01

Locus

Os05g0211100

Description

Similar to Cytochrome P450-like protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYP51G3

CGSNL Gene Name

P-450 51G3

Oryzabase Gene Symbol Synonym(s)

OsCYP51G3

Oryzabase Gene Name Synonym(s)

Cytochrome P450 51G3

Transcript Evidence

AK107185 (DDBJ, Best hit)

Protein Evidence

A1BQV2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: monooxygenase activity (GO:0004497)

Molecular Function: iron ion binding (GO:0005506)

Molecular Function: electron carrier activity (GO:0009055)

Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen (GO:0016705)

Molecular Function: heme binding (GO:0020037)

Functional domain (InterPro)

Cytochrome P450 (IPR001128)

Cytochrome P450, E-class, group IV (IPR002403)

Cytochrome P450, conserved site (IPR017972)

Full-length cDNA

002-124-H08 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0211100-01)

RiceXPro (AK107185)

Others

Oryzabase (17988)

KEGG (Os05t0211100-01 (EC:1.14.13.70))

Transcript

1619 bp

>Os05t0211100-01 Similar to Cytochrome P450-like protein.
TGTTCCTGGCTCAACTGTTCGTCGCTGCAACAATGTTGAGTAAGATTGCAACAAGAGAAA
GAACAAGAACCACTGGCACAAAATTCTCTAGACCACCGCCTCCACCCTTGGCCCGTGGAG
CTCCTCTTGTAGGGGTTTTACCATCGCTTCTCGCCAATGGCCCGGTGGAATTCATCCGCC
ACCATTATGAGAAGATGGGAAGCGTTTTCACTGTTAGCTTGCTCCAACAGAAGGTGACTT
TCTTGGTTGGGTCAGAGGCGTCAAGCCATTTTTACAAAGGGTTAGATTCAGAGATCAGCC
AGGATGAGGTCTCGCAATTCACCATACCAACCTTTGGTCCCGGGGTCGCTTTTGATGTGG
ATTATGCCACTCGACACGAGCAGTTCCGGTTCTTTGGTGATATCATGAAGCCGGCGAAGC
TGAGGACTTACGTTGATCTCATGGTTGCTGAAGTGGAGGGTTACTTTGCAAGATGGGGAC
AGTCCGGCACTGTGAACATGAAGCAAGAGTTTGAACAACTCGTCACCCTCATCGCTAGCC
GTTGTCTACTAGGGGAGGAGGTCAGGGACAAGATGTTCGACGAGGTCTCGACGCTCCTCC
GCGAGCTCAACGACGGCATGCGCCTCGTCACCATCCTGTTCCCGCGCCTCCCCATCCCGG
CGCACCGCCGGCGAGACAGGGCGCGCGCCAGGCTCGGCGAGATATTCTCCGACATCGTGA
GGTCCCGCAGGGGCAGCTCCGGCGGCGGCGGCGGCGGCGGCGGAGCCCGGCACGACGACA
TGCTGCAGTGCCTGATCGACGCGAGGTACAAGGACGGCCGCGCCACGACGGAGACGGAGG
TCGCCGGGATGCTCGTCGCGGCGCTCTTCGCCGGGCAGCACACGAGCTCCAGCACCAGCA
CCTGGGCCGGCGCGCGCCTCCTCACCAACCCCGACCACCTCCGCGCCGCCGTGGAGGAGC
AGGCGCGGCTACTCCGTCGGCACGGCGGCGACCGCGTCGACCACGCCGCCCTAGCGGCGA
TGGACACCCTGCAGCGCTGCGTGAAGGAGACCCTGCGGCTCCACCCGCCGGCCCTGATGC
TGCTGCGCCACGCGCGGCGGAGCTTCGTCGTGCGCGGCGGCAGCGGCGAGCGCGAGTACG
AGGTGCCCGAGGGCCACACGGTGGCGAGCCCGCTGCTGCTCCACAACGCGCTGCCGCGGG
TGTACCGGGACCCCGGCGAGTTCGACCCGGGCAGGTTCGGCGCCGGGAGGGAGGAGGGTG
CAGGTGGGCTGGCGTACACGGCGTTCGGCGGCGGGCGGCACGCGTGCGTGGGCGAGGCGT
TCGCGTACATGCAGATCAAGGTGATATGGAGCCACCTGCTGCGCAACTTCGAGCTGCAGC
TGGTGTCGCCGTTCCCGGAGACGGACTGGACCGTCGTCATGCCGGGGCCCAAGGGGAAGG
TCATGGTCACTTACAACAGGAGGAAACTTACCTAGTTATTATCAGTTAAAACTGGAGGTA
TAATCATCGTATGTGTTTAAGCATGTGTAAAACATCTCATCATGTATTCTCAACTAGTAC
ATAACTCATATCTATCTCTATCTTTTctctactattataaaaattgaagatgtgttttt

CDS

1443 bp

>Os05t0211100-01 Similar to Cytochrome P450-like protein.
ATGTTGAGTAAGATTGCAACAAGAGAAAGAACAAGAACCACTGGCACAAAATTCTCTAGA
CCACCGCCTCCACCCTTGGCCCGTGGAGCTCCTCTTGTAGGGGTTTTACCATCGCTTCTC
GCCAATGGCCCGGTGGAATTCATCCGCCACCATTATGAGAAGATGGGAAGCGTTTTCACT
GTTAGCTTGCTCCAACAGAAGGTGACTTTCTTGGTTGGGTCAGAGGCGTCAAGCCATTTT
TACAAAGGGTTAGATTCAGAGATCAGCCAGGATGAGGTCTCGCAATTCACCATACCAACC
TTTGGTCCCGGGGTCGCTTTTGATGTGGATTATGCCACTCGACACGAGCAGTTCCGGTTC
TTTGGTGATATCATGAAGCCGGCGAAGCTGAGGACTTACGTTGATCTCATGGTTGCTGAA
GTGGAGGGTTACTTTGCAAGATGGGGACAGTCCGGCACTGTGAACATGAAGCAAGAGTTT
GAACAACTCGTCACCCTCATCGCTAGCCGTTGTCTACTAGGGGAGGAGGTCAGGGACAAG
ATGTTCGACGAGGTCTCGACGCTCCTCCGCGAGCTCAACGACGGCATGCGCCTCGTCACC
ATCCTGTTCCCGCGCCTCCCCATCCCGGCGCACCGCCGGCGAGACAGGGCGCGCGCCAGG
CTCGGCGAGATATTCTCCGACATCGTGAGGTCCCGCAGGGGCAGCTCCGGCGGCGGCGGC
GGCGGCGGCGGAGCCCGGCACGACGACATGCTGCAGTGCCTGATCGACGCGAGGTACAAG
GACGGCCGCGCCACGACGGAGACGGAGGTCGCCGGGATGCTCGTCGCGGCGCTCTTCGCC
GGGCAGCACACGAGCTCCAGCACCAGCACCTGGGCCGGCGCGCGCCTCCTCACCAACCCC
GACCACCTCCGCGCCGCCGTGGAGGAGCAGGCGCGGCTACTCCGTCGGCACGGCGGCGAC
CGCGTCGACCACGCCGCCCTAGCGGCGATGGACACCCTGCAGCGCTGCGTGAAGGAGACC
CTGCGGCTCCACCCGCCGGCCCTGATGCTGCTGCGCCACGCGCGGCGGAGCTTCGTCGTG
CGCGGCGGCAGCGGCGAGCGCGAGTACGAGGTGCCCGAGGGCCACACGGTGGCGAGCCCG
CTGCTGCTCCACAACGCGCTGCCGCGGGTGTACCGGGACCCCGGCGAGTTCGACCCGGGC
AGGTTCGGCGCCGGGAGGGAGGAGGGTGCAGGTGGGCTGGCGTACACGGCGTTCGGCGGC
GGGCGGCACGCGTGCGTGGGCGAGGCGTTCGCGTACATGCAGATCAAGGTGATATGGAGC
CACCTGCTGCGCAACTTCGAGCTGCAGCTGGTGTCGCCGTTCCCGGAGACGGACTGGACC
GTCGTCATGCCGGGGCCCAAGGGGAAGGTCATGGTCACTTACAACAGGAGGAAACTTACC
TAG

Protein

481 aa

>Os05t0211100-01 Similar to Cytochrome P450-like protein.
MLSKIATRERTRTTGTKFSRPPPPPLARGAPLVGVLPSLLANGPVEFIRHHYEKMGSVFT
VSLLQQKVTFLVGSEASSHFYKGLDSEISQDEVSQFTIPTFGPGVAFDVDYATRHEQFRF
FGDIMKPAKLRTYVDLMVAEVEGYFARWGQSGTVNMKQEFEQLVTLIASRCLLGEEVRDK
MFDEVSTLLRELNDGMRLVTILFPRLPIPAHRRRDRARARLGEIFSDIVRSRRGSSGGGG
GGGGARHDDMLQCLIDARYKDGRATTETEVAGMLVAALFAGQHTSSSTSTWAGARLLTNP
DHLRAAVEEQARLLRRHGGDRVDHAALAAMDTLQRCVKETLRLHPPALMLLRHARRSFVV
RGGSGEREYEVPEGHTVASPLLLHNALPRVYRDPGEFDPGRFGAGREEGAGGLAYTAFGG
GRHACVGEAFAYMQIKVIWSHLLRNFELQLVSPFPETDWTVVMPGPKGKVMVTYNRRKLT
*

5'UTR

chr05:6884817..6884848 (- strand) : 32 bp

CDS

chr05:6884391..6884816 (- strand) : 426 bp

chr05:6882879..6883895 (- strand) : 1017 bp

3'UTR

chr05:6882735..6882878 (- strand) : 144 bp

FASTA

>Os05t0211100-01 class=Sequence position=chr05:6882735..6884848 (- strand)
TGTTCCTGGC TCAACTGTTC GTCGCTGCAA CAATGTTGAG TAAGATTGCA ACAAGAGAAA GAACAAGAAC CACTGGCACA
AAATTCTCTA GACCACCGCC TCCACCCTTG GCCCGTGGAG CTCCTCTTGT AGGGGTTTTA CCATCGCTTC TCGCCAATGG
CCCGGTGGAA TTCATCCGCC ACCATTATGA GAAGATGGGA AGCGTTTTCA CTGTTAGCTT GCTCCAACAG AAGGTGACTT
TCTTGGTTGG GTCAGAGGCG TCAAGCCATT TTTACAAAGG GTTAGATTCA GAGATCAGCC AGGATGAGGT CTCGCAATTC
ACCATACCAA CCTTTGGTCC CGGGGTCGCT TTTGATGTGG ATTATGCCAC TCGACACGAG CAGTTCCGGT TCTTTGGTGA
TATCATGAAG CCGGCGAAGC TGAGGACTTA CGTTGATCTC ATGGTTGCTG AAGTGGAGGT AAGCAAACGA GTTTTTGGCA
TGCACATTTA GTGTTGACAT GTTGCTTTAG TGAATAAAAG CAAATTCACT ACGGTAATAA ATTAAAATTA TATCCATATT
AAATTTTACC GTCCTTAAAA GTTAGCGGTA TATGCATCAA ATTTTACCAT AATAGTTTAA GTACCTTGAG ATACATGGAG
TTACTAAATT TTATAATACA AAATGTGGTA AATTTCGATG CAATCTCAAG GGTTGATCGT AGAGTTaggg tatatttggt
agagctccaa ttcctaaatt tagcttcagg agttgagtct ggagttaagt tgtggagtta tctaacccag ctccatatct
ctacttcatt ttgtgagtag ctccactccc attttacgtg gagctgaaac tgtttagctg agctctagct ccagaagagg
tggatctgga gctgtgccaa acaggcccAA GATATTAATT AACGTGGTAT GTGTCTATAT ACGCATTGTG CAGGGTTACT
TTGCAAGATG GGGACAGTCC GGCACTGTGA ACATGAAGCA AGAGTTTGAA CAACTCGTCA CCCTCATCGC TAGCCGTTGT
CTACTAGGGG AGGAGGTCAG GGACAAGATG TTCGACGAGG TCTCGACGCT CCTCCGCGAG CTCAACGACG GCATGCGCCT
CGTCACCATC CTGTTCCCGC GCCTCCCCAT CCCGGCGCAC CGCCGGCGAG ACAGGGCGCG CGCCAGGCTC GGCGAGATAT
TCTCCGACAT CGTGAGGTCC CGCAGGGGCA GCTCCGGCGG CGGCGGCGGC GGCGGCGGAG CCCGGCACGA CGACATGCTG
CAGTGCCTGA TCGACGCGAG GTACAAGGAC GGCCGCGCCA CGACGGAGAC GGAGGTCGCC GGGATGCTCG TCGCGGCGCT
CTTCGCCGGG CAGCACACGA GCTCCAGCAC CAGCACCTGG GCCGGCGCGC GCCTCCTCAC CAACCCCGAC CACCTCCGCG
CCGCCGTGGA GGAGCAGGCG CGGCTACTCC GTCGGCACGG CGGCGACCGC GTCGACCACG CCGCCCTAGC GGCGATGGAC
ACCCTGCAGC GCTGCGTGAA GGAGACCCTG CGGCTCCACC CGCCGGCCCT GATGCTGCTG CGCCACGCGC GGCGGAGCTT
CGTCGTGCGC GGCGGCAGCG GCGAGCGCGA GTACGAGGTG CCCGAGGGCC ACACGGTGGC GAGCCCGCTG CTGCTCCACA
ACGCGCTGCC GCGGGTGTAC CGGGACCCCG GCGAGTTCGA CCCGGGCAGG TTCGGCGCCG GGAGGGAGGA GGGTGCAGGT
GGGCTGGCGT ACACGGCGTT CGGCGGCGGG CGGCACGCGT GCGTGGGCGA GGCGTTCGCG TACATGCAGA TCAAGGTGAT
ATGGAGCCAC CTGCTGCGCA ACTTCGAGCT GCAGCTGGTG TCGCCGTTCC CGGAGACGGA CTGGACCGTC GTCATGCCGG
GGCCCAAGGG GAAGGTCATG GTCACTTACA ACAGGAGGAA ACTTACCTAG TTATTATCAG TTAAAACTGG AGGTATAATC
ATCGTATGTG TTTAAGCATG TGTAAAACAT CTCATCATGT ATTCTCAACT AGTACATAAC TCATATCTAT CTCTATCTTT
Tctctactat tataaaaatt gaagatgtgt tttt

Locus: Os05g0211100

Loading...

Locus: Os05g0211100

Loading...