Os05t0211100-02

Locus

Os05g0211100

Description

Obtusifoliol 14a-demethylase, Phytosterol and Brassinosteroid biosynthesis

RAP-DB Gene Symbol Synonym(s)

CYP51G3, OsCYP51G3

RAP-DB Gene Name Synonym(s)

P-450 51G3, Cytochrome P450 51G3

CGSNL Gene Symbol

CYP51G3

CGSNL Gene Name

P-450 51G3

Oryzabase Gene Symbol Synonym(s)

OsCYP51G3

Oryzabase Gene Name Synonym(s)

Cytochrome P450 51G3

Transcript Evidence

Inferred from literature

Protein Evidence

B9FIU9

Literature

PMID: 26083975

PMID: 21501172

Note

Manual Curation

October 19, 2015

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: monooxygenase activity (GO:0004497)

Molecular Function: iron ion binding (GO:0005506)

Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen (GO:0016705)

Molecular Function: heme binding (GO:0020037)

Functional domain (InterPro)

Cytochrome P450 (IPR001128)

Cytochrome P450, E-class, group IV (IPR002403)

Cytochrome P450, conserved site (IPR017972)

Others

Oryzabase (17988)

Transcript

1647 bp

>Os05t0211100-02 Obtusifoliol 14a-demethylase, Phytosterol and Brassinosteroid biosynthesis
ATGGATTTAACAACAGGAGCCATATGGTTGTTCCTGGCTCAACTGTTCGTCGCTGCAACA
ATGTTGAGTAAGATTGCAACAAGAGAAAGAACAAGAACCACTGGCACAAAATTCTCTAGA
CCACCGCCTCCACCCTTGGCCCGTGGAGCTCCTCTTGTAGGGGTTTTACCATCGCTTCTC
GCCAATGGCCCGGTGGAATTCATCCGCCACCATTATGAGAAGATGGGAAGCGTTTTCACT
GTTAGCTTGCTCCAACAGAAGGTGACTTTCTTGGTTGGGTCAGAGGCGTCAAGCCATTTT
TACAAAGGGTTAGATTCAGAGATCAGCCAGGATGAGGTCTCGCAATTCACCATACCAACC
TTTGGTCCCGGGGTCGCTTTTGATGTGGATTATGCCACTCGACACGAGCAGTTCCGGTTC
TTTGGTGATATCATGAAGCCGGCGAAGCTGAGGACTTACGTTGATCTCATGGTTGCTGAA
GTGGAGGGTTACTTTGCAAGATGGGGACAGTCCGGCACTGTGAACATGAAGCAAGAGTTT
GAACAACTCGTCACCCTCATCGCTAGCCGTTGTCTACTAGGGGAGGAGGTCAGGGACAAG
ATGTTCGACGAGGTCTCGACGCTCCTCCGCGAGCTCAACGACGGCATGCGCCTCGTCACC
ATCCTGTTCCCGCGCCTCCCCATCCCGGCGCACCGCCGGCGAGACAGGGCGCGCGCCAGG
CTCGGCGAGATATTCTCCGACATCGTGAGGTCCCGCAGGGGCAGCTCCGGCGGCGGCGGC
GGCGGCGGCGGAGCCCGGCACGACGACATGCTGCAGTGCCTGATCGACGCGAGGTACAAG
GACGGCCGCGCCACGACGGAGACGGAGGTCGCCGGGATGCTCGTCGCGGCGCTCTTCGCC
GGGCAGCACACGAGCTCCAGCACCAGCACCTGGGCCGGCGCGCGCCTCCTCACCAACCCC
GACCACCTCCGCGCCGCCGTGGAGGAGCAGGCGCGGCTACTCCGTCGGCACGGCGGCGAC
CGCGTCGACCACGCCGCCCTAGCGGCGATGGACACCCTGCAGCGCTGCGTGAAGGAGACC
CTGCGGCTCCACCCGCCGGCCCTGATGCTGCTGCGCCACGCGCGGCGGAGCTTCGTCGTG
CGCGGCGGCAGCGGCGAGCGCGAGTACGAGGTGCCCGAGGGCCACACGGTGGCGAGCCCG
CTGCTGCTCCACAACGCGCTGCCGCGGGTGTACCGGGACCCCGGCGAGTTCGACCCGGGC
AGGTTCGGCGCCGGGAGGGAGGAGGGTGCAGGTGGGCTGGCGTACACGGCGTTCGGCGGC
GGGCGGCACGCGTGCGTGGGCGAGGCGTTCGCGTACATGCAGATCAAGGTGATATGGAGC
CACCTGCTGCGCAACTTCGAGCTGCAGCTGGTGTCGCCGTTCCCGGAGACGGACTGGACC
GTCGTCATGCCGGGGCCCAAGGGGAAGGTCATGGTCACTTACAACAGGAGGAAACTTACC
TAGTTATTATCAGTTAAAACTGGAGGTATAATCATCGTATGTGTTTAAGCATGTGTAAAA
CATCTCATCATGTATTCTCAACTAGTACATAACTCATATCTATCTCTATCTTTTctctac
tattataaaaattgaagatgtgttttt

CDS

1503 bp

>Os05t0211100-02 Obtusifoliol 14a-demethylase, Phytosterol and Brassinosteroid biosynthesis
ATGGATTTAACAACAGGAGCCATATGGTTGTTCCTGGCTCAACTGTTCGTCGCTGCAACA
ATGTTGAGTAAGATTGCAACAAGAGAAAGAACAAGAACCACTGGCACAAAATTCTCTAGA
CCACCGCCTCCACCCTTGGCCCGTGGAGCTCCTCTTGTAGGGGTTTTACCATCGCTTCTC
GCCAATGGCCCGGTGGAATTCATCCGCCACCATTATGAGAAGATGGGAAGCGTTTTCACT
GTTAGCTTGCTCCAACAGAAGGTGACTTTCTTGGTTGGGTCAGAGGCGTCAAGCCATTTT
TACAAAGGGTTAGATTCAGAGATCAGCCAGGATGAGGTCTCGCAATTCACCATACCAACC
TTTGGTCCCGGGGTCGCTTTTGATGTGGATTATGCCACTCGACACGAGCAGTTCCGGTTC
TTTGGTGATATCATGAAGCCGGCGAAGCTGAGGACTTACGTTGATCTCATGGTTGCTGAA
GTGGAGGGTTACTTTGCAAGATGGGGACAGTCCGGCACTGTGAACATGAAGCAAGAGTTT
GAACAACTCGTCACCCTCATCGCTAGCCGTTGTCTACTAGGGGAGGAGGTCAGGGACAAG
ATGTTCGACGAGGTCTCGACGCTCCTCCGCGAGCTCAACGACGGCATGCGCCTCGTCACC
ATCCTGTTCCCGCGCCTCCCCATCCCGGCGCACCGCCGGCGAGACAGGGCGCGCGCCAGG
CTCGGCGAGATATTCTCCGACATCGTGAGGTCCCGCAGGGGCAGCTCCGGCGGCGGCGGC
GGCGGCGGCGGAGCCCGGCACGACGACATGCTGCAGTGCCTGATCGACGCGAGGTACAAG
GACGGCCGCGCCACGACGGAGACGGAGGTCGCCGGGATGCTCGTCGCGGCGCTCTTCGCC
GGGCAGCACACGAGCTCCAGCACCAGCACCTGGGCCGGCGCGCGCCTCCTCACCAACCCC
GACCACCTCCGCGCCGCCGTGGAGGAGCAGGCGCGGCTACTCCGTCGGCACGGCGGCGAC
CGCGTCGACCACGCCGCCCTAGCGGCGATGGACACCCTGCAGCGCTGCGTGAAGGAGACC
CTGCGGCTCCACCCGCCGGCCCTGATGCTGCTGCGCCACGCGCGGCGGAGCTTCGTCGTG
CGCGGCGGCAGCGGCGAGCGCGAGTACGAGGTGCCCGAGGGCCACACGGTGGCGAGCCCG
CTGCTGCTCCACAACGCGCTGCCGCGGGTGTACCGGGACCCCGGCGAGTTCGACCCGGGC
AGGTTCGGCGCCGGGAGGGAGGAGGGTGCAGGTGGGCTGGCGTACACGGCGTTCGGCGGC
GGGCGGCACGCGTGCGTGGGCGAGGCGTTCGCGTACATGCAGATCAAGGTGATATGGAGC
CACCTGCTGCGCAACTTCGAGCTGCAGCTGGTGTCGCCGTTCCCGGAGACGGACTGGACC
GTCGTCATGCCGGGGCCCAAGGGGAAGGTCATGGTCACTTACAACAGGAGGAAACTTACC
TAG

Protein

501 aa

>Os05t0211100-02 Obtusifoliol 14a-demethylase, Phytosterol and Brassinosteroid biosynthesis
MDLTTGAIWLFLAQLFVAATMLSKIATRERTRTTGTKFSRPPPPPLARGAPLVGVLPSLL
ANGPVEFIRHHYEKMGSVFTVSLLQQKVTFLVGSEASSHFYKGLDSEISQDEVSQFTIPT
FGPGVAFDVDYATRHEQFRFFGDIMKPAKLRTYVDLMVAEVEGYFARWGQSGTVNMKQEF
EQLVTLIASRCLLGEEVRDKMFDEVSTLLRELNDGMRLVTILFPRLPIPAHRRRDRARAR
LGEIFSDIVRSRRGSSGGGGGGGGARHDDMLQCLIDARYKDGRATTETEVAGMLVAALFA
GQHTSSSTSTWAGARLLTNPDHLRAAVEEQARLLRRHGGDRVDHAALAAMDTLQRCVKET
LRLHPPALMLLRHARRSFVVRGGSGEREYEVPEGHTVASPLLLHNALPRVYRDPGEFDPG
RFGAGREEGAGGLAYTAFGGGRHACVGEAFAYMQIKVIWSHLLRNFELQLVSPFPETDWT
VVMPGPKGKVMVTYNRRKLT*

CDS

chr05:6884391..6884876 (- strand) : 486 bp

chr05:6882879..6883895 (- strand) : 1017 bp

3'UTR

chr05:6882735..6882878 (- strand) : 144 bp

FASTA

>Os05t0211100-02 class=Sequence position=chr05:6882735..6884876 (- strand)
ATGGATTTAA CAACAGGAGC CATATGGTTG TTCCTGGCTC AACTGTTCGT CGCTGCAACA ATGTTGAGTA AGATTGCAAC
AAGAGAAAGA ACAAGAACCA CTGGCACAAA ATTCTCTAGA CCACCGCCTC CACCCTTGGC CCGTGGAGCT CCTCTTGTAG
GGGTTTTACC ATCGCTTCTC GCCAATGGCC CGGTGGAATT CATCCGCCAC CATTATGAGA AGATGGGAAG CGTTTTCACT
GTTAGCTTGC TCCAACAGAA GGTGACTTTC TTGGTTGGGT CAGAGGCGTC AAGCCATTTT TACAAAGGGT TAGATTCAGA
GATCAGCCAG GATGAGGTCT CGCAATTCAC CATACCAACC TTTGGTCCCG GGGTCGCTTT TGATGTGGAT TATGCCACTC
GACACGAGCA GTTCCGGTTC TTTGGTGATA TCATGAAGCC GGCGAAGCTG AGGACTTACG TTGATCTCAT GGTTGCTGAA
GTGGAGGTAA GCAAACGAGT TTTTGGCATG CACATTTAGT GTTGACATGT TGCTTTAGTG AATAAAAGCA AATTCACTAC
GGTAATAAAT TAAAATTATA TCCATATTAA ATTTTACCGT CCTTAAAAGT TAGCGGTATA TGCATCAAAT TTTACCATAA
TAGTTTAAGT ACCTTGAGAT ACATGGAGTT ACTAAATTTT ATAATACAAA ATGTGGTAAA TTTCGATGCA ATCTCAAGGG
TTGATCGTAG AGTTagggta tatttggtag agctccaatt cctaaattta gcttcaggag ttgagtctgg agttaagttg
tggagttatc taacccagct ccatatctct acttcatttt gtgagtagct ccactcccat tttacgtgga gctgaaactg
tttagctgag ctctagctcc agaagaggtg gatctggagc tgtgccaaac aggcccAAGA TATTAATTAA CGTGGTATGT
GTCTATATAC GCATTGTGCA GGGTTACTTT GCAAGATGGG GACAGTCCGG CACTGTGAAC ATGAAGCAAG AGTTTGAACA
ACTCGTCACC CTCATCGCTA GCCGTTGTCT ACTAGGGGAG GAGGTCAGGG ACAAGATGTT CGACGAGGTC TCGACGCTCC
TCCGCGAGCT CAACGACGGC ATGCGCCTCG TCACCATCCT GTTCCCGCGC CTCCCCATCC CGGCGCACCG CCGGCGAGAC
AGGGCGCGCG CCAGGCTCGG CGAGATATTC TCCGACATCG TGAGGTCCCG CAGGGGCAGC TCCGGCGGCG GCGGCGGCGG
CGGCGGAGCC CGGCACGACG ACATGCTGCA GTGCCTGATC GACGCGAGGT ACAAGGACGG CCGCGCCACG ACGGAGACGG
AGGTCGCCGG GATGCTCGTC GCGGCGCTCT TCGCCGGGCA GCACACGAGC TCCAGCACCA GCACCTGGGC CGGCGCGCGC
CTCCTCACCA ACCCCGACCA CCTCCGCGCC GCCGTGGAGG AGCAGGCGCG GCTACTCCGT CGGCACGGCG GCGACCGCGT
CGACCACGCC GCCCTAGCGG CGATGGACAC CCTGCAGCGC TGCGTGAAGG AGACCCTGCG GCTCCACCCG CCGGCCCTGA
TGCTGCTGCG CCACGCGCGG CGGAGCTTCG TCGTGCGCGG CGGCAGCGGC GAGCGCGAGT ACGAGGTGCC CGAGGGCCAC
ACGGTGGCGA GCCCGCTGCT GCTCCACAAC GCGCTGCCGC GGGTGTACCG GGACCCCGGC GAGTTCGACC CGGGCAGGTT
CGGCGCCGGG AGGGAGGAGG GTGCAGGTGG GCTGGCGTAC ACGGCGTTCG GCGGCGGGCG GCACGCGTGC GTGGGCGAGG
CGTTCGCGTA CATGCAGATC AAGGTGATAT GGAGCCACCT GCTGCGCAAC TTCGAGCTGC AGCTGGTGTC GCCGTTCCCG
GAGACGGACT GGACCGTCGT CATGCCGGGG CCCAAGGGGA AGGTCATGGT CACTTACAAC AGGAGGAAAC TTACCTAGTT
ATTATCAGTT AAAACTGGAG GTATAATCAT CGTATGTGTT TAAGCATGTG TAAAACATCT CATCATGTAT TCTCAACTAG
TACATAACTC ATATCTATCT CTATCTTTTc tctactatta taaaaattga agatgtgttt tt

Locus: Os05g0211100

Loading...

Locus: Os05g0211100

Loading...