Os05t0212300-01

Locus

Os05g0212300

Description

Similar to Endo-beta-1,4-glucanase precursor (EC 3.2.1.4).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GH9C4

CGSNL Gene Name

GLYCOSIDE HYDROLASE 9C4

Oryzabase Gene Symbol Synonym(s)

OsGH9C4

Oryzabase Gene Name Synonym(s)

glycoside hydrolase OsGH9C4, glycoside hydrolase 9C4

Transcript Evidence

AK063458 (DDBJ, Best hit)

AK099370 (DDBJ, Best hit)

Protein Evidence

Q5NAT0 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: carbohydrate metabolic process (GO:0005975)

Cellular Component: extracellular region (GO:0005576)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds (GO:0004553)

Molecular Function: carbohydrate binding (GO:0030246)

Functional domain (InterPro)

Glycoside hydrolase, family 9 (IPR001701)

Six-hairpin glycosidase-like (IPR008928)

Six-hairpin glycosidase (IPR012341)

Glycoside hydrolase, family 9, active site (IPR018221)

Carbohydrate binding domain CBM49 (IPR019028)

Full-length cDNA

001-115-G09 (Online Clone Ordering)

J033048N02 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0212300-01)

Others

Oryzabase (11722)

Transcript

2206 bp

>Os05t0212300-01 Similar to Endo-beta-1,4-glucanase precursor (EC 3.2.1.4).
AAGCCAACCAAAGTCCTCTGCTCCCCTGCTCCTTCACTCTGCTTCACTCTCACTCACTCA
CCTTCTTGGTACATTGCAATTTTGCAATGGCCAAGAATGGTGGTGCTCACGGTGCAGCCA
CATTGTTTGGTCTCTTGGCACTTGCATCAATGGTGAAGCTGGGATTTGTTGCTGGGGGTG
GCCATGACTATGCCATGGCATTGAGGAAGAGCATCCTCTACTTCCAGGCGCAGCGGTCCG
GCGTTCTCCCTCCTAACCAGAGGGTCTCCTGGAGAGCCAGCTCTGGCCTCTTTGATGGAA
AGGCCAATGGAGTTGATCTTGTTGGAGGTTATTATGATGCAGGGGACAATGTCAAGTTTG
GGTTGCCAATGGCGTTCACGGTGACCATGATGTCGTGGAGCATATTAGAGTACGGCAAGC
AGATGGCGGCGGCCGGCGAGCTCCGGAACGCCATGGACGCCGTCAAGTGGGGCACCGACT
ACTTCATCAAGGCGCACCCGgagcccgacgtgctctacggcgaggtcggcgacggcgaca
ccgaccacagctgctggcagcggccggaggacatgacgacgaGCCGCCAGGCGTTCCGCG
TCGACCCCCAGCACCCCGGGTCAGACCTCGCCGCCGAGACCGCCGCCGCCATGGCCGCCG
CGTCCATCGTCTTCCGCGGCACGTACCCTGGCTACGCCAACCTCCTCCTTGTGCACTCCA
AGCAGCTGTTCGAGTTCGCCGACAAGTACCGGGGCAAGTACGACGCCAGCATCACGGTGG
CGCGAAACTACTACGGCTCCTTCAGCGGATACGGGGACGAGCTGCTCTGGGCGGCGGCGT
GGCTGTTCGAGGCGACGGAGGACAGGTCCTACCTGGAGTACCTCGCCGGCAACGGCGAGG
CGCTGGGCGGGACGGGGTGGTCCATCAACCAGTTCGGGTGGGACGTCAAGTACCCCGGCG
TGCAGGTCCTCGCCGCCAAGTTCCTCCTCCAGGGCCGCGCCGGCGACCACGCCGCCGCGC
TGCAGAGGTACAGGCAGAACGCGGAGTTCTTTGTGTGctcctgcgtcggcaagggcgccg
tcaacgtcgccaggacccccggcggcatgatgtaccaccagaggtggaacaacctccagt
tcgtcaccagcgcctccttcctcctcaccgtctacgccgacttcgccgccatctccggcc
gcggcgccgtccactgccccgccggcgcCGCCCAACCATTCGACATCCTCAAATTCGTCA
AATCTCAGGTGAATTATATTTTGGGTGATAATCCGAGGGGGACGAGCTACATGGTCGGGT
ACGGCGCGAGCTACCCGCGGCAGGTGCACCACCGCGGCGCGTCCATCGTGTCCATCAAGA
GGGACCCGTCGTTCGTGAGCTGCCAGGAGGGGTACTCGTCGTGGTACGGGAGGGAAGCCG
GCAACCCGAACCTGCTCGACGGCGCCGTCGTCGGCGGGCCCGACGAGTACGACGACTTCG
CCGACGAGCGCGACAACTACGAGCAGACGGAGGCCGCCACCTACAACAACGCGCCGCTGC
TCGGCGTCCTCGCCCGCCTCGCCGCCTCCTGCGGCGGCCTCAAGGAGGAGGAATACGAAC
AAGAAACGGCGACTCCGGTCGTGAACCGGACGTCGTCGTCGTCGTCGCTGCCGgcgacgg
cgacggcgatcgggatcgagcagaacgtgacggggacgtgggcgaggaggcggaggacgt
actaccggtacgcggtgacggtgacgaacaggtcgcgggggaagacggtgagggagctgc
acctgggcgtgtcggggctccgggggcggctgtgggggctggaggaggcgaggtacgggt
acgtgccgccgaggtggctgccggcgctgcggccggggaggagcctcaggttcgtgtacg
tgcagccggcgccggcgccggcgaACATCTGGGTCACCGGCTACAAACTGGTCTGAAATG
AACTCAAGTACTCAACTATTCTGAAATGGTAATTTGTGGTAGAGAGAGAGTAGAGTGTGG
TTATTTGGAGGAAGTAGAGAAGAGTCCAAGGAACGCGAGTACGTATACTCATCCTCTTCC
TCCTCGAATACTATGATTTTAGGGGTTTGGAGAGATGAGATTTAGTTGTTCATCGTCCTC
CTTTTGCCCTATCAAGTTTAATTAAGTAACTATTAATATGCGACTG

CDS

1890 bp

>Os05t0212300-01 Similar to Endo-beta-1,4-glucanase precursor (EC 3.2.1.4).
ATGGCCAAGAATGGTGGTGCTCACGGTGCAGCCACATTGTTTGGTCTCTTGGCACTTGCA
TCAATGGTGAAGCTGGGATTTGTTGCTGGGGGTGGCCATGACTATGCCATGGCATTGAGG
AAGAGCATCCTCTACTTCCAGGCGCAGCGGTCCGGCGTTCTCCCTCCTAACCAGAGGGTC
TCCTGGAGAGCCAGCTCTGGCCTCTTTGATGGAAAGGCCAATGGAGTTGATCTTGTTGGA
GGTTATTATGATGCAGGGGACAATGTCAAGTTTGGGTTGCCAATGGCGTTCACGGTGACC
ATGATGTCGTGGAGCATATTAGAGTACGGCAAGCAGATGGCGGCGGCCGGCGAGCTCCGG
AACGCCATGGACGCCGTCAAGTGGGGCACCGACTACTTCATCAAGGCGCACCCGgagccc
gacgtgctctacggcgaggtcggcgacggcgacaccgaccacagctgctggcagcggccg
gaggacatgacgacgaGCCGCCAGGCGTTCCGCGTCGACCCCCAGCACCCCGGGTCAGAC
CTCGCCGCCGAGACCGCCGCCGCCATGGCCGCCGCGTCCATCGTCTTCCGCGGCACGTAC
CCTGGCTACGCCAACCTCCTCCTTGTGCACTCCAAGCAGCTGTTCGAGTTCGCCGACAAG
TACCGGGGCAAGTACGACGCCAGCATCACGGTGGCGCGAAACTACTACGGCTCCTTCAGC
GGATACGGGGACGAGCTGCTCTGGGCGGCGGCGTGGCTGTTCGAGGCGACGGAGGACAGG
TCCTACCTGGAGTACCTCGCCGGCAACGGCGAGGCGCTGGGCGGGACGGGGTGGTCCATC
AACCAGTTCGGGTGGGACGTCAAGTACCCCGGCGTGCAGGTCCTCGCCGCCAAGTTCCTC
CTCCAGGGCCGCGCCGGCGACCACGCCGCCGCGCTGCAGAGGTACAGGCAGAACGCGGAG
TTCTTTGTGTGctcctgcgtcggcaagggcgccgtcaacgtcgccaggacccccggcggc
atgatgtaccaccagaggtggaacaacctccagttcgtcaccagcgcctccttcctcctc
accgtctacgccgacttcgccgccatctccggccgcggcgccgtccactgccccgccggc
gcCGCCCAACCATTCGACATCCTCAAATTCGTCAAATCTCAGGTGAATTATATTTTGGGT
GATAATCCGAGGGGGACGAGCTACATGGTCGGGTACGGCGCGAGCTACCCGCGGCAGGTG
CACCACCGCGGCGCGTCCATCGTGTCCATCAAGAGGGACCCGTCGTTCGTGAGCTGCCAG
GAGGGGTACTCGTCGTGGTACGGGAGGGAAGCCGGCAACCCGAACCTGCTCGACGGCGCC
GTCGTCGGCGGGCCCGACGAGTACGACGACTTCGCCGACGAGCGCGACAACTACGAGCAG
ACGGAGGCCGCCACCTACAACAACGCGCCGCTGCTCGGCGTCCTCGCCCGCCTCGCCGCC
TCCTGCGGCGGCCTCAAGGAGGAGGAATACGAACAAGAAACGGCGACTCCGGTCGTGAAC
CGGACGTCGTCGTCGTCGTCGCTGCCGgcgacggcgacggcgatcgggatcgagcagaac
gtgacggggacgtgggcgaggaggcggaggacgtactaccggtacgcggtgacggtgacg
aacaggtcgcgggggaagacggtgagggagctgcacctgggcgtgtcggggctccggggg
cggctgtgggggctggaggaggcgaggtacgggtacgtgccgccgaggtggctgccggcg
ctgcggccggggaggagcctcaggttcgtgtacgtgcagccggcgccggcgccggcgaAC
ATCTGGGTCACCGGCTACAAACTGGTCTGA

Protein

630 aa

>Os05t0212300-01 Similar to Endo-beta-1,4-glucanase precursor (EC 3.2.1.4).
MAKNGGAHGAATLFGLLALASMVKLGFVAGGGHDYAMALRKSILYFQAQRSGVLPPNQRV
SWRASSGLFDGKANGVDLVGGYYDAGDNVKFGLPMAFTVTMMSWSILEYGKQMAAAGELR
NAMDAVKWGTDYFIKAHPEPDVLYGEVGDGDTDHSCWQRPEDMTTSRQAFRVDPQHPGSD
LAAETAAAMAAASIVFRGTYPGYANLLLVHSKQLFEFADKYRGKYDASITVARNYYGSFS
GYGDELLWAAAWLFEATEDRSYLEYLAGNGEALGGTGWSINQFGWDVKYPGVQVLAAKFL
LQGRAGDHAAALQRYRQNAEFFVCSCVGKGAVNVARTPGGMMYHQRWNNLQFVTSASFLL
TVYADFAAISGRGAVHCPAGAAQPFDILKFVKSQVNYILGDNPRGTSYMVGYGASYPRQV
HHRGASIVSIKRDPSFVSCQEGYSSWYGREAGNPNLLDGAVVGGPDEYDDFADERDNYEQ
TEAATYNNAPLLGVLARLAASCGGLKEEEYEQETATPVVNRTSSSSSLPATATAIGIEQN
VTGTWARRRRTYYRYAVTVTNRSRGKTVRELHLGVSGLRGRLWGLEEARYGYVPPRWLPA
LRPGRSLRFVYVQPAPAPANIWVTGYKLV*

5'UTR

chr05:6944507..6944592 (- strand) : 86 bp

CDS

chr05:6944282..6944506 (- strand) : 225 bp

chr05:6943727..6944140 (- strand) : 414 bp

chr05:6943551..6943640 (- strand) : 90 bp

chr05:6943027..6943479 (- strand) : 453 bp

chr05:6942125..6942832 (- strand) : 708 bp

3'UTR

chr05:6941895..6942124 (- strand) : 230 bp

FASTA

>Os05t0212300-01 class=Sequence position=chr05:6941895..6944592 (- strand)
AAGCCAACCA AAGTCCTCTG CTCCCCTGCT CCTTCACTCT GCTTCACTCT CACTCACTCA CCTTCTTGGT ACATTGCAAT
TTTGCAATGG CCAAGAATGG TGGTGCTCAC GGTGCAGCCA CATTGTTTGG TCTCTTGGCA CTTGCATCAA TGGTGAAGCT
GGGATTTGTT GCTGGGGGTG GCCATGACTA TGCCATGGCA TTGAGGAAGA GCATCCTCTA CTTCCAGGCG CAGCGGTCCG
GCGTTCTCCC TCCTAACCAG AGGGTCTCCT GGAGAGCCAG CTCTGGCCTC TTTGATGGAA AGGCCAATGG AGTATGCACC
ATTCTACCTT CAAATCTTTG ATCAAAACCA TGATGCCATC AATGGCATTG TGTTCAATTT GTTCAGGAGA TATGATGAGT
TGGGTTCTAA TGGAGTGCAA TGCAAATGTT TGTGTTTTTG TTTGTCTTTC AGGTTGATCT TGTTGGAGGT TATTATGATG
CAGGGGACAA TGTCAAGTTT GGGTTGCCAA TGGCGTTCAC GGTGACCATG ATGTCGTGGA GCATATTAGA GTACGGCAAG
CAGATGGCGG CGGCCGGCGA GCTCCGGAAC GCCATGGACG CCGTCAAGTG GGGCACCGAC TACTTCATCA AGGCGCACCC
Ggagcccgac gtgctctacg gcgaggtcgg cgacggcgac accgaccaca gctgctggca gcggccggag gacatgacga
cgaGCCGCCA GGCGTTCCGC GTCGACCCCC AGCACCCCGG GTCAGACCTC GCCGCCGAGA CCGCCGCCGC CATGGCCGCC
GCGTCCATCG TCTTCCGCGG CACGTACCCT GGCTACGCCA ACCTCCTCCT TGTGCACTCC AAGCAGGTCG GTCATCCAAA
CACTCCAAGA ACTCTCGCAA ATGAGCTCGA AATCAAACGA AATTTCCTCT GAAAATTTTG TGGCGCGTTC AGCTGTTCGA
GTTCGCCGAC AAGTACCGGG GCAAGTACGA CGCCAGCATC ACGGTGGCGC GAAACTACTA CGGCTCCTTC AGCGGATACG
GGGTAAGTGG CGTGGCGGCG GCGCCGTAGG ATTCGGACGA ACACCTTGCT GACATGACCT GATCTTGCTG CAGGACGAGC
TGCTCTGGGC GGCGGCGTGG CTGTTCGAGG CGACGGAGGA CAGGTCCTAC CTGGAGTACC TCGCCGGCAA CGGCGAGGCG
CTGGGCGGGA CGGGGTGGTC CATCAACCAG TTCGGGTGGG ACGTCAAGTA CCCCGGCGTG CAGGTCCTCG CCGCCAAGTT
CCTCCTCCAG GGCCGCGCCG GCGACCACGC CGCCGCGCTG CAGAGGTACA GGCAGAACGC GGAGTTCTTT GTGTGctcct
gcgtcggcaa gggcgccgtc aacgtcgcca ggacccccgg cggcatgatg taccaccaga ggtggaacaa cctccagttc
gtcaccagcg cctccttcct cctcaccgtc tacgccgact tcgccgccat ctccggccgc ggcgccgtcc actgccccgc
cggcgcCGCC CAACCATTCG ACATCCTCAA ATTCGTCAAA TCTCAGGTAA AAAACAAACA AAAACATTGT CAAAGGCCGT
GCAAttgtat ggtttttgag ccggttttcc ttataaacag ggtcaactct gtccttctaa tatattcggc aatactctca
ccgcttccac ttcacgagaa aaaaaAAACA TTGTCAAATG TGGTTGACGA ATTACTCAAA TTTTGTCGAA TTGATTTCAG
GTGAATTATA TTTTGGGTGA TAATCCGAGG GGGACGAGCT ACATGGTCGG GTACGGCGCG AGCTACCCGC GGCAGGTGCA
CCACCGCGGC GCGTCCATCG TGTCCATCAA GAGGGACCCG TCGTTCGTGA GCTGCCAGGA GGGGTACTCG TCGTGGTACG
GGAGGGAAGC CGGCAACCCG AACCTGCTCG ACGGCGCCGT CGTCGGCGGG CCCGACGAGT ACGACGACTT CGCCGACGAG
CGCGACAACT ACGAGCAGAC GGAGGCCGCC ACCTACAACA ACGCGCCGCT GCTCGGCGTC CTCGCCCGCC TCGCCGCCTC
CTGCGGCGGC CTCAAGGAGG AGGAATACGA ACAAGAAACG GCGACTCCGG TCGTGAACCG GACGTCGTCG TCGTCGTCGC
TGCCGgcgac ggcgacggcg atcgggatcg agcagaacgt gacggggacg tgggcgagga ggcggaggac gtactaccgg
tacgcggtga cggtgacgaa caggtcgcgg gggaagacgg tgagggagct gcacctgggc gtgtcggggc tccgggggcg
gctgtggggg ctggaggagg cgaggtacgg gtacgtgccg ccgaggtggc tgccggcgct gcggccgggg aggagcctca
ggttcgtgta cgtgcagccg gcgccggcgc cggcgaACAT CTGGGTCACC GGCTACAAAC TGGTCTGAAA TGAACTCAAG
TACTCAACTA TTCTGAAATG GTAATTTGTG GTAGAGAGAG AGTAGAGTGT GGTTATTTGG AGGAAGTAGA GAAGAGTCCA
AGGAACGCGA GTACGTATAC TCATCCTCTT CCTCCTCGAA TACTATGATT TTAGGGGTTT GGAGAGATGA GATTTAGTTG
TTCATCGTCC TCCTTTTGCC CTATCAAGTT TAATTAAGTA ACTATTAATA TGCGACTG

Locus: Os05g0212300

Loading...

Locus: Os05g0212300

Loading...