Os05t0212900-00

Locus

Os05g0212900

Description

Similar to Chalcone synthase J (EC 2.3.1.74) (Naringenin-chalcone synthase J).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

CHS, OsPKS06, OsPKS6, PKS06, PKS6, OsCHS6, CHS6

Oryzabase Gene Name Synonym(s)

chalcone synthase, polyketide synthase 6, Chalcone synthase 6

Transcript Evidence

ab initio prediction

Protein Evidence

Q7G630 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: metabolic process (GO:0008152)

Biological Process: biosynthetic process (GO:0009058)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: transferase activity, transferring acyl groups (GO:0016746)

Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups (GO:0016747)

Functional domain (InterPro)

Chalcone/stilbene synthase, N-terminal (IPR001099)

Polyketide synthase, type III (IPR011141)

Chalcone/stilbene synthase, C-terminal (IPR012328)

Thiolase-like, subgroup (IPR016038)

Thiolase-like (IPR016039)

Expression Databases

TENOR (Os05t0212900-00)

Others

Oryzabase (17791)

KEGG (Os05t0212900-00 (EC:2.3.1.74))

Transcript

1179 bp

>Os05t0212900-00 Similar to Chalcone synthase J (EC 2.3.1.74) (Naringenin-chalcone synthase J).
ATGCCTGGAGCAGCTGCTGCCGCTGTTGTTGACAGCCGCCTGTGCACACAGCACGCGGAA
GGCCCTGCTGCGGTCCTCGCCATCGGCACTGCAAACCCGGCAAATATCGTCTATCAAGAT
GGGTTTGCCGACTACTACTTTGGTCTAACCAAGAGCGAGCATCTTATTGAGCTGAAGGAC
AAAATGAAGAGGATATGTCACAGATCGGGAATAGAGAAACGCTACATCCACCTTGATGAC
AAGCTCATCTGTGAGCACCCGGAGATCATCGACAAACACATGCCCTCCCTTGAAACTCGT
GTAGACATCGTCTCTACTGAGGTCCCGAAGCTCGCCGAGTCAGCCACACGGAAGGCCATC
GCCGAGTGGGGCCGTCCGGCCATTGACATTACGCACCTCATCTTCAGCACCTACTCCGGG
TGCAGTGCTCCTAGCGCTGACCTCAAGCTGGCATCACTACTCGGCCTCAACCCTTCTGTT
TCTCGCACCATCCTTAGCCTCCACGGTTGCTCTGGAGGCGGTAGGGCACTTCAACTTGCC
AAGGAGCTCACCGAGAACAACCGTGATGCACGCGTTCTCGTAGCCTGTGCCGAGCTGACG
CTAATATGCTTCTCAAACCCAGATGAAAGCAAAATTGTCGGCCATGGACTGTTTGGGGAT
GGTGCCGGAGCAATCATTGTCGGCGCTGGCCCACTGGTCGATGAAGAGCGCCCACTATTC
GAGATGGTCCTCGCCTCGCAAACAACGATACCAAGTACTGAGCATGCACTTGGCATGCAG
ACCACCGCCAGTGGCATAGATTTCCACCTCTCTATCCAGGTGCCAACACTGATCAAGGAC
AACATCCGGCAGTGCTTGCTTGACACATTCCGATCGGTTGGAAACATGGATCCTAATTGG
AATGACCTCTTCTGGGCAGTGCACCCTGGTGGCCGTGCGATCCTTGACAACATAGAAGGC
GAGCTTCAGCTGCAACCAGCAAAGCTTGCGGCAAGCCGCCATGTGTTGAACGAGTATGGG
AATATGAGCGGCACGACGATCGCGTTTGTTCTTGATGACTTGCGTCGCCGTCGGGAGAAG
GAAGGAGATCAGCATCAACAACTTGAGTGGGGAGTAATGCTAGCCTTTGGACCAGGTATC
ACAATAGAGGCAATGGTGCTGCGTAACCCACTCTCATGA

CDS

1179 bp

>Os05t0212900-00 Similar to Chalcone synthase J (EC 2.3.1.74) (Naringenin-chalcone synthase J).
ATGCCTGGAGCAGCTGCTGCCGCTGTTGTTGACAGCCGCCTGTGCACACAGCACGCGGAA
GGCCCTGCTGCGGTCCTCGCCATCGGCACTGCAAACCCGGCAAATATCGTCTATCAAGAT
GGGTTTGCCGACTACTACTTTGGTCTAACCAAGAGCGAGCATCTTATTGAGCTGAAGGAC
AAAATGAAGAGGATATGTCACAGATCGGGAATAGAGAAACGCTACATCCACCTTGATGAC
AAGCTCATCTGTGAGCACCCGGAGATCATCGACAAACACATGCCCTCCCTTGAAACTCGT
GTAGACATCGTCTCTACTGAGGTCCCGAAGCTCGCCGAGTCAGCCACACGGAAGGCCATC
GCCGAGTGGGGCCGTCCGGCCATTGACATTACGCACCTCATCTTCAGCACCTACTCCGGG
TGCAGTGCTCCTAGCGCTGACCTCAAGCTGGCATCACTACTCGGCCTCAACCCTTCTGTT
TCTCGCACCATCCTTAGCCTCCACGGTTGCTCTGGAGGCGGTAGGGCACTTCAACTTGCC
AAGGAGCTCACCGAGAACAACCGTGATGCACGCGTTCTCGTAGCCTGTGCCGAGCTGACG
CTAATATGCTTCTCAAACCCAGATGAAAGCAAAATTGTCGGCCATGGACTGTTTGGGGAT
GGTGCCGGAGCAATCATTGTCGGCGCTGGCCCACTGGTCGATGAAGAGCGCCCACTATTC
GAGATGGTCCTCGCCTCGCAAACAACGATACCAAGTACTGAGCATGCACTTGGCATGCAG
ACCACCGCCAGTGGCATAGATTTCCACCTCTCTATCCAGGTGCCAACACTGATCAAGGAC
AACATCCGGCAGTGCTTGCTTGACACATTCCGATCGGTTGGAAACATGGATCCTAATTGG
AATGACCTCTTCTGGGCAGTGCACCCTGGTGGCCGTGCGATCCTTGACAACATAGAAGGC
GAGCTTCAGCTGCAACCAGCAAAGCTTGCGGCAAGCCGCCATGTGTTGAACGAGTATGGG
AATATGAGCGGCACGACGATCGCGTTTGTTCTTGATGACTTGCGTCGCCGTCGGGAGAAG
GAAGGAGATCAGCATCAACAACTTGAGTGGGGAGTAATGCTAGCCTTTGGACCAGGTATC
ACAATAGAGGCAATGGTGCTGCGTAACCCACTCTCATGA

Protein

393 aa

>Os05t0212900-00 Similar to Chalcone synthase J (EC 2.3.1.74) (Naringenin-chalcone synthase J).
MPGAAAAAVVDSRLCTQHAEGPAAVLAIGTANPANIVYQDGFADYYFGLTKSEHLIELKD
KMKRICHRSGIEKRYIHLDDKLICEHPEIIDKHMPSLETRVDIVSTEVPKLAESATRKAI
AEWGRPAIDITHLIFSTYSGCSAPSADLKLASLLGLNPSVSRTILSLHGCSGGGRALQLA
KELTENNRDARVLVACAELTLICFSNPDESKIVGHGLFGDGAGAIIVGAGPLVDEERPLF
EMVLASQTTIPSTEHALGMQTTASGIDFHLSIQVPTLIKDNIRQCLLDTFRSVGNMDPNW
NDLFWAVHPGGRAILDNIEGELQLQPAKLAASRHVLNEYGNMSGTTIAFVLDDLRRRREK
EGDQHQQLEWGVMLAFGPGITIEAMVLRNPLS*

CDS

chr05:6993467..6993662 (- strand) : 196 bp

chr05:6991465..6992447 (- strand) : 983 bp

FASTA

>Os05t0212900-00 class=Sequence position=chr05:6991465..6993662 (- strand)
ATGCCTGGAG CAGCTGCTGC CGCTGTTGTT GACAGCCGCC TGTGCACACA GCACGCGGAA GGCCCTGCTG CGGTCCTCGC
CATCGGCACT GCAAACCCGG CAAATATCGT CTATCAAGAT GGGTTTGCCG ACTACTACTT TGGTCTAACC AAGAGCGAGC
ATCTTATTGA GCTGAAGGAC AAAATGAAGA GGATATGTAA GTAGAACAAT CCTTTCATTT CGATCGTTGC ATTGATCATC
ATTATCGTTA GTTGTTTTTC ATAAACTCTA ATGAGAATAA ATTATGCAAG CGCTTAAATT TTTAGGACAC TCCTGCCATA
ATTCATTATA AACCATACAA ATATTTATAC TATACTACGT AGAAAGAAGA GTGAAATGAT GTTGGAGTTC AGCCAAATTT
TCTTTATTTC GCGTGTGGGA TGCAATGTGG ATGCATGGGG TGTGGTTGCA TCCCAAAATT TTTGAAAAAA AATCTACTAT
ATACAGTATA TACTTGGTAC ATATACGCAG TATGCTCAAT ACGAGGCCCA CTTAAGGTCA TCCAGGACTA TATGCTCCAT
TTGAATTTCT ACATTATTTA TGTCATTGTA TTTGTACTCG CTATATTTAA GTGTTTTGCT AGTATATTTT TTTCACTTTA
TCTCTTATCT TGAATCATAA CAGTAAAGTT TTGCATCTCC ATCTCTGAAA TCCTGGATCC ACCACTAATA CCTCGTTAAA
TATGATAGTT TGTCATATAA TGTCCCTCCT GCTCATCAGG CTACCATCTC GCACCCATGC CACTGTACTC GTATAGATTT
AAAGACTACG CTTTTAACAA AAATACAAGA GATCTACAGA GTAGTCATAG CAATAAATCC GTGGATCTTA ATAAATTTGT
ACTGAAAAAT AGCACTTACT TGTCTATATG TTGGCACCGG GAATTGAGTC TTAGTGGATA GAGTTATGCA CCCACAAGTA
CATCATTAGA CCATGTTTGA ACGAAACATA TGTGCTAATC CAATCTTTCA GAACATTAAA CTCATGATTA TCTTCCTAAA
AATAGGACAT ATATAAACCA TTTTTGTTTT ATTACGGAAA ATGCTTGCAT AATATCATAT ATTCTTGTTT TGTAAATATT
CGGCATCTTA ATTGAAATGT CTCATGTTAT TCTTATAATC TCTTAGTGCT ATGTACTAAT TGTAAGAGAT GTGGGTGCAT
CCTTTTCCAT TTCAGGTCAC AGATCGGGAA TAGAGAAACG CTACATCCAC CTTGATGACA AGCTCATCTG TGAGCACCCG
GAGATCATCG ACAAACACAT GCCCTCCCTT GAAACTCGTG TAGACATCGT CTCTACTGAG GTCCCGAAGC TCGCCGAGTC
AGCCACACGG AAGGCCATCG CCGAGTGGGG CCGTCCGGCC ATTGACATTA CGCACCTCAT CTTCAGCACC TACTCCGGGT
GCAGTGCTCC TAGCGCTGAC CTCAAGCTGG CATCACTACT CGGCCTCAAC CCTTCTGTTT CTCGCACCAT CCTTAGCCTC
CACGGTTGCT CTGGAGGCGG TAGGGCACTT CAACTTGCCA AGGAGCTCAC CGAGAACAAC CGTGATGCAC GCGTTCTCGT
AGCCTGTGCC GAGCTGACGC TAATATGCTT CTCAAACCCA GATGAAAGCA AAATTGTCGG CCATGGACTG TTTGGGGATG
GTGCCGGAGC AATCATTGTC GGCGCTGGCC CACTGGTCGA TGAAGAGCGC CCACTATTCG AGATGGTCCT CGCCTCGCAA
ACAACGATAC CAAGTACTGA GCATGCACTT GGCATGCAGA CCACCGCCAG TGGCATAGAT TTCCACCTCT CTATCCAGGT
GCCAACACTG ATCAAGGACA ACATCCGGCA GTGCTTGCTT GACACATTCC GATCGGTTGG AAACATGGAT CCTAATTGGA
ATGACCTCTT CTGGGCAGTG CACCCTGGTG GCCGTGCGAT CCTTGACAAC ATAGAAGGCG AGCTTCAGCT GCAACCAGCA
AAGCTTGCGG CAAGCCGCCA TGTGTTGAAC GAGTATGGGA ATATGAGCGG CACGACGATC GCGTTTGTTC TTGATGACTT
GCGTCGCCGT CGGGAGAAGG AAGGAGATCA GCATCAACAA CTTGAGTGGG GAGTAATGCT AGCCTTTGGA CCAGGTATCA
CAATAGAGGC AATGGTGCTG CGTAACCCAC TCTCATGA

Locus: Os05g0212900

Loading...

Locus: Os05g0212900

Loading...