Os05t0230700-01

Locus

Os05g0230700

Description

Similar to Auxin-responsive protein IAA17.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IAA17

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIAA17

Oryzabase Gene Name Synonym(s)

Aux/IAA protein 17

Transcript Evidence

AK106192 (DDBJ, Best hit)

AK105936 (DDBJ, Best hit)

Protein Evidence

Q75GB1 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

AUX/IAA protein (IPR003311)

Aux/IAA-ARF-dimerisation (IPR011525)

Full-length cDNA

001-208-E03 (Online Clone Ordering)

001-205-B07 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0230700-01)

Others

Oryzabase (10906)

Transcript

1249 bp

>Os05t0230700-01 Similar to Auxin-responsive protein IAA17.
ACACACACACACTCTCTTCTCTTGTCTCGCTGTGGCTCGCTGGACACAACACACACCCAC
ACCCACTCCCCCACTCTCTCTCCGGTTCATGTCCTGCTGCTCCCCATGTCGCCCCCACTC
GAGCTCGACTACATAGGCCTCTCGCCGCCGGTGCCCGCCGCCGCCGATGCCGCCGCCGAC
AACGACCTGAAGGGCACCGAGCTCCGCCTCGGCCTGCCCGGCTCCCACTCGCCGGACCGC
TCCCCGCCCGCCGCCACGCTCGACCTTCTCCCCGCTGCCAAGGGCGCCAAGCGCGGGTTC
TCCGACGAGGCGCGTCCGCTGCCGGCGTCCGCCGCCGCCGCCGCCGCCGCCGGGAAGGGC
AAGAAGGCGGCGGCCGGCGAGGAGGATGAGGATGCGGAGGAGGAGGACAAGAAGGTCGCC
GCCGCGCCGCAGGCGCCTGCTGCCAAGGCTCAGGTGGTTGGATGGCCACCAATTCGCAGC
TACCGCAAGAACACGATGGCTACTAACCAGCTGAAGAGCAGCAAGGAGGATGCTGAAGCG
AAGCAGGGCCAGGGGTTCCTGTACGTCAAGGTCAGCATGGATGGTGCCCCCTACCTCAGG
AAGGTGGACCTCAAGACCTACAAGAACTACAAGGACCTGTCAACTGCGCTTGAGAAGATG
TTCATTGGCTTCACAACTGGCAAGGATGGCTTATCTGAGAGCCGCAAGGATGGTGAATAT
GTGCTGACTTATGAAGACAAGGATGGAGACTGGATGCTTGTTGGCGATGTTCCATGGGAG
ATGTTTGCCAACTCTTGTCGCAGACTCAGGATCATGAAAGGTTCAGATGCAATTGGACTT
GCTCCAAGGGCAGTTGATAAGTCCAAAAACCGCAACTAGAATGGTTTCTGCCCCACAGTC
AAAAGCAAGATGGAGATCAAATGACTGTAGGGAATTTTCTGAAAACCAAGAAGTCTAACA
GTTTTAAGATGGAGTCTGCCTTATGGTCTGTACTACATGGTTTGCTATTGTGAAAGTTAA
AAAAAAAGGTGTCTTGTTATGTTAGCTTCGCCAAATCTCCTAGGGACATAAACTCTATTT
GATTGTGCCCAAGTCTTTGTACGTGTGTTAATGCTATTCGTGTAAATGGTTTGGACACCA
TGTGCTACTGCTATGATTGAGCACCCCTACCTACTTTGCAAAATGTTGTCAATGAACTGT
TTGTTCGCTACATAAATGTTCAATGAAGCTTGCAAATGTATTGTCCACC

CDS

774 bp

>Os05t0230700-01 Similar to Auxin-responsive protein IAA17.
ATGTCGCCCCCACTCGAGCTCGACTACATAGGCCTCTCGCCGCCGGTGCCCGCCGCCGCC
GATGCCGCCGCCGACAACGACCTGAAGGGCACCGAGCTCCGCCTCGGCCTGCCCGGCTCC
CACTCGCCGGACCGCTCCCCGCCCGCCGCCACGCTCGACCTTCTCCCCGCTGCCAAGGGC
GCCAAGCGCGGGTTCTCCGACGAGGCGCGTCCGCTGCCGGCGTCCGCCGCCGCCGCCGCC
GCCGCCGGGAAGGGCAAGAAGGCGGCGGCCGGCGAGGAGGATGAGGATGCGGAGGAGGAG
GACAAGAAGGTCGCCGCCGCGCCGCAGGCGCCTGCTGCCAAGGCTCAGGTGGTTGGATGG
CCACCAATTCGCAGCTACCGCAAGAACACGATGGCTACTAACCAGCTGAAGAGCAGCAAG
GAGGATGCTGAAGCGAAGCAGGGCCAGGGGTTCCTGTACGTCAAGGTCAGCATGGATGGT
GCCCCCTACCTCAGGAAGGTGGACCTCAAGACCTACAAGAACTACAAGGACCTGTCAACT
GCGCTTGAGAAGATGTTCATTGGCTTCACAACTGGCAAGGATGGCTTATCTGAGAGCCGC
AAGGATGGTGAATATGTGCTGACTTATGAAGACAAGGATGGAGACTGGATGCTTGTTGGC
GATGTTCCATGGGAGATGTTTGCCAACTCTTGTCGCAGACTCAGGATCATGAAAGGTTCA
GATGCAATTGGACTTGCTCCAAGGGCAGTTGATAAGTCCAAAAACCGCAACTAG

Protein

258 aa

>Os05t0230700-01 Similar to Auxin-responsive protein IAA17.
MSPPLELDYIGLSPPVPAAADAAADNDLKGTELRLGLPGSHSPDRSPPAATLDLLPAAKG
AKRGFSDEARPLPASAAAAAAAGKGKKAAAGEEDEDAEEEDKKVAAAPQAPAAKAQVVGW
PPIRSYRKNTMATNQLKSSKEDAEAKQGQGFLYVKVSMDGAPYLRKVDLKTYKNYKDLST
ALEKMFIGFTTGKDGLSESRKDGEYVLTYEDKDGDWMLVGDVPWEMFANSCRRLRIMKGS
DAIGLAPRAVDKSKNRN*

5'UTR

chr05:7950915..7951019 (+ strand) : 105 bp

CDS

chr05:7951020..7951360 (+ strand) : 341 bp

chr05:7952068..7952300 (+ strand) : 233 bp

chr05:7953040..7953139 (+ strand) : 100 bp

chr05:7953252..7953313 (+ strand) : 62 bp

chr05:7953967..7954004 (+ strand) : 38 bp

3'UTR

chr05:7954005..7954374 (+ strand) : 370 bp

FASTA

>Os05t0230700-01 class=Sequence position=chr05:7950915..7954374 (+ strand)
ACACACACAC ACTCTCTTCT CTTGTCTCGC TGTGGCTCGC TGGACACAAC ACACACCCAC ACCCACTCCC CCACTCTCTC
TCCGGTTCAT GTCCTGCTGC TCCCCATGTC GCCCCCACTC GAGCTCGACT ACATAGGCCT CTCGCCGCCG GTGCCCGCCG
CCGCCGATGC CGCCGCCGAC AACGACCTGA AGGGCACCGA GCTCCGCCTC GGCCTGCCCG GCTCCCACTC GCCGGACCGC
TCCCCGCCCG CCGCCACGCT CGACCTTCTC CCCGCTGCCA AGGGCGCCAA GCGCGGGTTC TCCGACGAGG CGCGTCCGCT
GCCGGCGTCC GCCGCCGCCG CCGCCGCCGC CGGGAAGGGC AAGAAGGCGG CGGCCGGCGA GGAGGATGAG GATGCGGAGG
AGGAGGACAA GAAGGTCGCC GCCGCGCCGC AGGCGCCTGC TGCCAAGTAT GTTCGGAATT GCGGATTGTG GCTTTGATTT
CCTTCTTTGG GGTTCCTCTT TTTTTCTTGG GAAAAAAAAT AAAAGATGGT TTTGTAAATT GTGAAGCTCT GGCCTCTGGG
TTGCTATAAG GAGAATTTTG GTGAAAAATT GTTTTTGTTT GGTATGATGA AGCATTTTCA GTTTTGTAGA AATATTTTTT
TCCCAGGCTG ATATGTTTGA TATGGTGTTT TTTCTTGAGT TTTGGGAAAC AAAAGTAGGG AGTTGAGAGA GTTGTGGGCA
AAGGTTGAAT TTTTGTGTCA ATAGATCCTT TGTTTCAGTT CAATTTTGCC TCTCCTTTTT TCCCTGTGAA TTTGGCTTCT
CTGCCGTTAA TTAGAGGAGG GAAGGAAAAG GTTTTGAGTT ATTCTTCCTG AATTTCCACT TTTGCTCTTT TCTTCAAATT
TCTCACTTTA CAAAGTTGCC TCCTTTTTCT TTTAACTTGA GCTTTCTTGC AACTCTTTTT TTTTTCCTCA AATCCTTCTA
TTACCAAGTT TTATCATCTT TAAGGTGTTC CTTTCTGCTG CATTTTCTTG GCAGCCTTTT GATCTGACAT TACTTTGCTC
GAATTCTTTT GCTCTTGAGC CTAATTGGTT TCTGTATTCC CTCCCTGCAC ATGAGTAGAG CTAGAACATG TAGTGATCTG
ACTCCTCCTT GTGCATGATG TGTTGTTGTG CAGGGCTCAG GTGGTTGGAT GGCCACCAAT TCGCAGCTAC CGCAAGAACA
CGATGGCTAC TAACCAGCTG AAGAGCAGCA AGGAGGATGC TGAAGCGAAG CAGGGCCAGG GGTTCCTGTA CGTCAAGGTC
AGCATGGATG GTGCCCCCTA CCTCAGGAAG GTGGACCTCA AGACCTACAA GAACTACAAG GACCTGTCAA CTGCGCTTGA
GAAGATGTTC ATTGGCTTCA CAACTGGTGA GATGTCTCGG GTTACCCTGC TTGCATTTCT CTTTGTAATT GCATTTCCTT
TTGATGTGGA TGCTCTTACA ATTACATCGT CTAGGATGCC TGTGACTAGG AACCAATATA TGCTTGATCT GTACAAGTAA
CTTTTGCCGG TAACATGGAT TTGTTCCTAG TAGTTTTAAG ATCACAAAAG GCGGGTTATG GTTCATTTAG TTGTTTTAAG
ATCACAAACA GCAATTTATG GTTCACTAAT TTTTACAAGA AAGCGAAAGA GGCCTTATTT ATTATGTGCT GATTGTATTT
GTACTATACA TCTTCCAAAA AGATTGTATT TTTAAAGATA AATTAAAATT GGCTCTAATT CTAATTTTGT GATCATCGTA
CAGGTCTTTT TTTAGTTCTG AACATTGCTC AATGCAGATC ATCTTTATTT CTGAATATTA ATCATCGTCA ATTCGGATGG
CATATTGTTT TAATTGCCTT TTCCGAATGT ATTTCAATTA TTTCTTGCTG TTTTGATTAT TTTTATTTCA GATTACGTAG
GAAATATACT TTCATTATAC TAATAGTTAT ACCGCCTTTT CTCGATAATT AATAGACACA TTGCTTAGTA ATATTTTTTT
TGTAAAAATC TAGAAAGTGA GAACAAGCGC GAATTTTTGC AATAGAAATT TTAGTACAAG GAGAGATTCT CTTCTGTTTG
TTTTATTTGG CCTTACAGGT TAGTGTGGAT GTATTGCCAT ATCAGGCAAG GATGGCTTAT CTGAGAGCCG CAAGGATGGT
GAATATGTGC TGACTTATGA AGACAAGGAT GGAGACTGGA TGCTTGTTGG CGATGTTCCA TGGGAGTAAG TACACTAGTT
CTTATCTAGT TATCATCGCA AAGAAAGAAG TAATAACACC AATGAGATCG AAGAAATAAA AATGCTGTTA CTGAAGAACT
TTTGATTTAA ATTGCAGGAT GTTTGCCAAC TCTTGTCGCA GACTCAGGAT CATGAAAGGT TCAGATGCAA TTGGACTTGG
TAAGTTTGTA TGTTTATTAT GTTGAATTGC ACGTTCGGCT GATCTCATTT TATTTCCCTT TAAATTGCAC TTGTAGACCT
ATGTGTTTTT GACACAGAGT TTAAATGCAT CATGTGACAT ACTTGCTCAG TTTCAAAATA TAAGCATTCC TGGAATATAT
TTGGAACAGA GGGAGTATCA GTTTAGGAAT ATTGGTTTTC TTGTGCTTTC TTTCAAATTC AACTTAGCAA TTCATACTTC
ATGCTGTAGG GCATGTTGAA CCAGGGCTGG TGACATAACT CAAAATACTC TAAAATCAAG GAAACCATAA CTCATTATGC
TATATCGATA TGTTGGATGC TTGTATTTAA GAGGTAGATG TGCAATTACG GTTGAAGGTG TCATGCATGT ATCTAACCAG
CGCTATAAAA AAGCTAACTG ATTGAGATCT GAGTCTTACT ATTGATGTTC TTGTTCTAAT GCATTGTTTC ACCATGATTC
CTTTGTGCAC TAATCATGGA ATGAATTATT GGATGTCAAA CTTATAATGC TTTGAATGGC ATTATGTGGT TGTTAGCTGT
TATCATTCAA TGGCTTCACC TTCTTTTAGT TGTTAGTTTG CATTTTTACA CATGGCTCGG TAATTTACTT GTCTTGTTTC
TTTCTCATGC AGCTCCAAGG GCAGTTGATA AGTCCAAAAA CCGCAACTAG AATGGTTTCT GCCCCACAGT CAAAAGCAAG
ATGGAGATCA AATGACTGTA GGGAATTTTC TGAAAACCAA GAAGTCTAAC AGTTTTAAGA TGGAGTCTGC CTTATGGTCT
GTACTACATG GTTTGCTATT GTGAAAGTTA AAAAAAAAGG TGTCTTGTTA TGTTAGCTTC GCCAAATCTC CTAGGGACAT
AAACTCTATT TGATTGTGCC CAAGTCTTTG TACGTGTGTT AATGCTATTC GTGTAAATGG TTTGGACACC ATGTGCTACT
GCTATGATTG AGCACCCCTA CCTACTTTGC AAAATGTTGT CAATGAACTG TTTGTTCGCT ACATAAATGT TCAATGAAGC
TTGCAAATGT ATTGTCCACC 

Locus: Os05g0230700

Loading...

Locus: Os05g0230700

Loading...