Os05t0230700-02

Locus

Os05g0230700

Description

Similar to Auxin-responsive protein IAA17.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IAA17

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIAA17

Oryzabase Gene Name Synonym(s)

Aux/IAA protein 17

Transcript Evidence

AK102762 (DDBJ, Best hit)

Protein Evidence

Q75GB1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

AUX/IAA protein (IPR003311)

Aux/IAA-ARF-dimerisation (IPR011525)

Full-length cDNA

J033107D08 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0230700-02)

RiceXPro (AK102762)

Others

Oryzabase (10906)

KEGG (Os05t0230700-02)

Transcript

1148 bp

>Os05t0230700-02 Similar to Auxin-responsive protein IAA17.
GTGGCTCGCTGGACACAACACACACCCACACCCACTCCCCCACTCTCTCTCCGGTTCATG
TCCTGCTGCTCCCCATGTCGCCCCCACTCGAGCTCGACTACATAGGCCTCTCGCCGCCGG
TGCCCGCCGCCGCCGATGCCGCCGCCGACAACGACCTGAAGGGCACCGAGCTCCGCCTCG
GCCTGCCCGGCTCCCACTCGCCGGACCGCTCCCCGCCCGCCGCCACGCTCGACCTTCTCC
CCGCTGCCAAGGGCGCCAAGCGCGGGTTCTCCGACGAGGCGCGTCCGCTGCCGGCGTCCG
CCGCCGCCGCCGCCGCCGCCGGGAAGGGCAAGAAGGCGGCGGCCGGCGAGGAGGATGAGG
ATGCGGAGGAGGAGGACAAGAAGGTCGCCGCCGCGCCGCAGGCGCCTGCTGCCAAGGCTC
AGGTGGTTGGATGGCCACCAATTCGCAGCTACCGCAAGAACACGATGGCTACTAACCAGC
TGAAGAGCAGCAAGGAGGATGCTGAAGCGAAGCAGGGCCAGGGGTTCCTGTACGTCAAGG
TCAGCATGGATGGTGCCCCCTACCTCAGGAAGGTGGACCTCAAGACCTACAAGAACTACA
AGGACCTGTCAACTGCGCTTGAGAAGATGTTCATTGGCTTCACAACTGGCAAGGATGGCT
TATCTGAGAGCCGCAAGGATGGTGAATATGTGCTGACTTATGAAGACAAGGATGGAGACT
GGATGCTTGTTGGCGATGTTCCATGGGAGATGTTTGCCAACTCTTGTCGCAGACTCAGGA
TCATGAAAGGTTCAGATGCAATTGGACTTGCTCCAAGGGCAGTTGATAAGTCCAAAAACC
GCAACTAGAATGGTTTCTGCCCCACAGTCAAAAGCAAGATGGAGATCAAATGACTGTAGG
GAATTTTCTGAAAACCAAGAAGTCTAACAGTTTTAAGATGGAGTCTGCCTTATGGTCTGT
ACTACATGGTTTGCTATTGTGAAAGTTAAAAAAAAAGGTGTCTTGTTATGTTAGCTTCGC
CAAATCTCCTAGGGACATAAACTCTATTTGATTGTGCCCAAGTCTTTGTACGTGTGTTAA
TGCTATTCGTGTAAATGGTTTGGACACCATGTGCTACTGCTATGATTGAGCACCCCTACC
TACTTTGC

CDS

774 bp

>Os05t0230700-02 Similar to Auxin-responsive protein IAA17.
ATGTCGCCCCCACTCGAGCTCGACTACATAGGCCTCTCGCCGCCGGTGCCCGCCGCCGCC
GATGCCGCCGCCGACAACGACCTGAAGGGCACCGAGCTCCGCCTCGGCCTGCCCGGCTCC
CACTCGCCGGACCGCTCCCCGCCCGCCGCCACGCTCGACCTTCTCCCCGCTGCCAAGGGC
GCCAAGCGCGGGTTCTCCGACGAGGCGCGTCCGCTGCCGGCGTCCGCCGCCGCCGCCGCC
GCCGCCGGGAAGGGCAAGAAGGCGGCGGCCGGCGAGGAGGATGAGGATGCGGAGGAGGAG
GACAAGAAGGTCGCCGCCGCGCCGCAGGCGCCTGCTGCCAAGGCTCAGGTGGTTGGATGG
CCACCAATTCGCAGCTACCGCAAGAACACGATGGCTACTAACCAGCTGAAGAGCAGCAAG
GAGGATGCTGAAGCGAAGCAGGGCCAGGGGTTCCTGTACGTCAAGGTCAGCATGGATGGT
GCCCCCTACCTCAGGAAGGTGGACCTCAAGACCTACAAGAACTACAAGGACCTGTCAACT
GCGCTTGAGAAGATGTTCATTGGCTTCACAACTGGCAAGGATGGCTTATCTGAGAGCCGC
AAGGATGGTGAATATGTGCTGACTTATGAAGACAAGGATGGAGACTGGATGCTTGTTGGC
GATGTTCCATGGGAGATGTTTGCCAACTCTTGTCGCAGACTCAGGATCATGAAAGGTTCA
GATGCAATTGGACTTGCTCCAAGGGCAGTTGATAAGTCCAAAAACCGCAACTAG

Protein

258 aa

>Os05t0230700-02 Similar to Auxin-responsive protein IAA17.
MSPPLELDYIGLSPPVPAAADAAADNDLKGTELRLGLPGSHSPDRSPPAATLDLLPAAKG
AKRGFSDEARPLPASAAAAAAAGKGKKAAAGEEDEDAEEEDKKVAAAPQAPAAKAQVVGW
PPIRSYRKNTMATNQLKSSKEDAEAKQGQGFLYVKVSMDGAPYLRKVDLKTYKNYKDLST
ALEKMFIGFTTGKDGLSESRKDGEYVLTYEDKDGDWMLVGDVPWEMFANSCRRLRIMKGS
DAIGLAPRAVDKSKNRN*

5'UTR

chr05:7950946..7951019 (+ strand) : 74 bp

CDS

chr05:7951020..7951360 (+ strand) : 341 bp

chr05:7952068..7952300 (+ strand) : 233 bp

chr05:7953040..7953139 (+ strand) : 100 bp

chr05:7953252..7953313 (+ strand) : 62 bp

chr05:7953967..7954004 (+ strand) : 38 bp

3'UTR

chr05:7954005..7954304 (+ strand) : 300 bp

FASTA

>Os05t0230700-02 class=Sequence position=chr05:7950946..7954304 (+ strand)
GTGGCTCGCT GGACACAACA CACACCCACA CCCACTCCCC CACTCTCTCT CCGGTTCATG TCCTGCTGCT CCCCATGTCG
CCCCCACTCG AGCTCGACTA CATAGGCCTC TCGCCGCCGG TGCCCGCCGC CGCCGATGCC GCCGCCGACA ACGACCTGAA
GGGCACCGAG CTCCGCCTCG GCCTGCCCGG CTCCCACTCG CCGGACCGCT CCCCGCCCGC CGCCACGCTC GACCTTCTCC
CCGCTGCCAA GGGCGCCAAG CGCGGGTTCT CCGACGAGGC GCGTCCGCTG CCGGCGTCCG CCGCCGCCGC CGCCGCCGCC
GGGAAGGGCA AGAAGGCGGC GGCCGGCGAG GAGGATGAGG ATGCGGAGGA GGAGGACAAG AAGGTCGCCG CCGCGCCGCA
GGCGCCTGCT GCCAAGTATG TTCGGAATTG CGGATTGTGG CTTTGATTTC CTTCTTTGGG GTTCCTCTTT TTTTCTTGGG
AAAAAAAATA AAAGATGGTT TTGTAAATTG TGAAGCTCTG GCCTCTGGGT TGCTATAAGG AGAATTTTGG TGAAAAATTG
TTTTTGTTTG GTATGATGAA GCATTTTCAG TTTTGTAGAA ATATTTTTTT CCCAGGCTGA TATGTTTGAT ATGGTGTTTT
TTCTTGAGTT TTGGGAAACA AAAGTAGGGA GTTGAGAGAG TTGTGGGCAA AGGTTGAATT TTTGTGTCAA TAGATCCTTT
GTTTCAGTTC AATTTTGCCT CTCCTTTTTT CCCTGTGAAT TTGGCTTCTC TGCCGTTAAT TAGAGGAGGG AAGGAAAAGG
TTTTGAGTTA TTCTTCCTGA ATTTCCACTT TTGCTCTTTT CTTCAAATTT CTCACTTTAC AAAGTTGCCT CCTTTTTCTT
TTAACTTGAG CTTTCTTGCA ACTCTTTTTT TTTTCCTCAA ATCCTTCTAT TACCAAGTTT TATCATCTTT AAGGTGTTCC
TTTCTGCTGC ATTTTCTTGG CAGCCTTTTG ATCTGACATT ACTTTGCTCG AATTCTTTTG CTCTTGAGCC TAATTGGTTT
CTGTATTCCC TCCCTGCACA TGAGTAGAGC TAGAACATGT AGTGATCTGA CTCCTCCTTG TGCATGATGT GTTGTTGTGC
AGGGCTCAGG TGGTTGGATG GCCACCAATT CGCAGCTACC GCAAGAACAC GATGGCTACT AACCAGCTGA AGAGCAGCAA
GGAGGATGCT GAAGCGAAGC AGGGCCAGGG GTTCCTGTAC GTCAAGGTCA GCATGGATGG TGCCCCCTAC CTCAGGAAGG
TGGACCTCAA GACCTACAAG AACTACAAGG ACCTGTCAAC TGCGCTTGAG AAGATGTTCA TTGGCTTCAC AACTGGTGAG
ATGTCTCGGG TTACCCTGCT TGCATTTCTC TTTGTAATTG CATTTCCTTT TGATGTGGAT GCTCTTACAA TTACATCGTC
TAGGATGCCT GTGACTAGGA ACCAATATAT GCTTGATCTG TACAAGTAAC TTTTGCCGGT AACATGGATT TGTTCCTAGT
AGTTTTAAGA TCACAAAAGG CGGGTTATGG TTCATTTAGT TGTTTTAAGA TCACAAACAG CAATTTATGG TTCACTAATT
TTTACAAGAA AGCGAAAGAG GCCTTATTTA TTATGTGCTG ATTGTATTTG TACTATACAT CTTCCAAAAA GATTGTATTT
TTAAAGATAA ATTAAAATTG GCTCTAATTC TAATTTTGTG ATCATCGTAC AGGTCTTTTT TTAGTTCTGA ACATTGCTCA
ATGCAGATCA TCTTTATTTC TGAATATTAA TCATCGTCAA TTCGGATGGC ATATTGTTTT AATTGCCTTT TCCGAATGTA
TTTCAATTAT TTCTTGCTGT TTTGATTATT TTTATTTCAG ATTACGTAGG AAATATACTT TCATTATACT AATAGTTATA
CCGCCTTTTC TCGATAATTA ATAGACACAT TGCTTAGTAA TATTTTTTTT GTAAAAATCT AGAAAGTGAG AACAAGCGCG
AATTTTTGCA ATAGAAATTT TAGTACAAGG AGAGATTCTC TTCTGTTTGT TTTATTTGGC CTTACAGGTT AGTGTGGATG
TATTGCCATA TCAGGCAAGG ATGGCTTATC TGAGAGCCGC AAGGATGGTG AATATGTGCT GACTTATGAA GACAAGGATG
GAGACTGGAT GCTTGTTGGC GATGTTCCAT GGGAGTAAGT ACACTAGTTC TTATCTAGTT ATCATCGCAA AGAAAGAAGT
AATAACACCA ATGAGATCGA AGAAATAAAA ATGCTGTTAC TGAAGAACTT TTGATTTAAA TTGCAGGATG TTTGCCAACT
CTTGTCGCAG ACTCAGGATC ATGAAAGGTT CAGATGCAAT TGGACTTGGT AAGTTTGTAT GTTTATTATG TTGAATTGCA
CGTTCGGCTG ATCTCATTTT ATTTCCCTTT AAATTGCACT TGTAGACCTA TGTGTTTTTG ACACAGAGTT TAAATGCATC
ATGTGACATA CTTGCTCAGT TTCAAAATAT AAGCATTCCT GGAATATATT TGGAACAGAG GGAGTATCAG TTTAGGAATA
TTGGTTTTCT TGTGCTTTCT TTCAAATTCA ACTTAGCAAT TCATACTTCA TGCTGTAGGG CATGTTGAAC CAGGGCTGGT
GACATAACTC AAAATACTCT AAAATCAAGG AAACCATAAC TCATTATGCT ATATCGATAT GTTGGATGCT TGTATTTAAG
AGGTAGATGT GCAATTACGG TTGAAGGTGT CATGCATGTA TCTAACCAGC GCTATAAAAA AGCTAACTGA TTGAGATCTG
AGTCTTACTA TTGATGTTCT TGTTCTAATG CATTGTTTCA CCATGATTCC TTTGTGCACT AATCATGGAA TGAATTATTG
GATGTCAAAC TTATAATGCT TTGAATGGCA TTATGTGGTT GTTAGCTGTT ATCATTCAAT GGCTTCACCT TCTTTTAGTT
GTTAGTTTGC ATTTTTACAC ATGGCTCGGT AATTTACTTG TCTTGTTTCT TTCTCATGCA GCTCCAAGGG CAGTTGATAA
GTCCAAAAAC CGCAACTAGA ATGGTTTCTG CCCCACAGTC AAAAGCAAGA TGGAGATCAA ATGACTGTAG GGAATTTTCT
GAAAACCAAG AAGTCTAACA GTTTTAAGAT GGAGTCTGCC TTATGGTCTG TACTACATGG TTTGCTATTG TGAAAGTTAA
AAAAAAAGGT GTCTTGTTAT GTTAGCTTCG CCAAATCTCC TAGGGACATA AACTCTATTT GATTGTGCCC AAGTCTTTGT
ACGTGTGTTA ATGCTATTCG TGTAAATGGT TTGGACACCA TGTGCTACTG CTATGATTGA GCACCCCTAC CTACTTTGC

Locus: Os05g0230700

Loading...

Locus: Os05g0230700

Loading...