Os05t0235800-01

Locus

Os05g0235800

Description

DNA-dependent ATPase MCM domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

MCM6

CGSNL Gene Name

MINI-CHROMOSOME MAINTENANCE PROTEIN 6

Oryzabase Gene Symbol Synonym(s)

OsMCM6

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK102937 (DDBJ, Best hit)

Protein Evidence

NP_001105289.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: DNA replication (GO:0006260)

Biological Process: DNA-dependent DNA replication initiation (GO:0006270)

Cellular Component: nucleus (GO:0005634)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Mini-chromosome maintenance, DNA-dependent ATPase (IPR001208)

Mini-chromosome maintenance complex protein 6 (IPR008049)

Nucleic acid-binding, OB-fold (IPR012340)

Nucleic acid-binding, OB-fold-like (IPR016027)

Mini-chromosome maintenance, conserved site (IPR018525)

Full-length cDNA

J033114J19 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0235800-01)

RiceXPro (AK102937)

Others

Oryzabase (9198)

KEGG (Os05t0235800-01)

Transcript

2975 bp

>Os05t0235800-01 DNA-dependent ATPase MCM domain containing protein.
CTTGTTCCCCCAACCAAAACCCTCGCGCCCCCGCCGCACCACCCGCGCAGCCGCACAGCG
CAAATCCCCCCCACCCCGCGCAAGGTTTCGAGAGGTCTCGTCGGAGATGGAGGCGTTCGG
CGGGTTCTTCGTGGACGAGAAGGCGGCGCGGGTGGAGAACATCTTCCTCGAGTTCCTCAG
GCGGTTCAAGGAGGCGGATGCGGCGGAGGCGTTCTACGAGACGGAGCTGGAGGCGATGCG
GTCGCGGGAGTCCACCACCATGTACGTCGACTTCGCCCACGTCATGCGATTCAACGACGT
CCTCCAGAAGGCCATCTCCGAGGAGTATCTCAGGTTCGAGCCGTACCTCCGGAATGCGTG
CAAGAGGTTTGTGATGGAGCAGAGGACTGGCGAGAACCGTGCACCAATCATCTCTGATGA
TAGCCCTAACAAGGACATTAACATTGCCTTCTACAACATACCAATGCTGAAGAGGTTGAG
GGAGCTTGGAACAGCAGAGATTGGTAAGCTCACGGCTGTAATGGGGGTGGTTACACGGAC
AAGTGAGGTCCGGCCTGAGTTACTGCAAGGCACCTTCAAGTGCCTTGACTGTGGAAATGT
TGTAAAGAATGTTGAGCAGCAGTTCAAGTATACTGAGCCAATAATATGTGTCAATGCAAC
ATGCCAAAATCGATCAAAATGGGCCCTTCTCCGACAAGAGAGCAAGTTCACAGATTGGCA
GCGGGTCAGGATGCAGGAGACATCAAAAGAAATACCTGCTGGTTCACTACCACGCTCCCT
GGATGTCATTCTGAGGCATGAGATTGTTGAGAAGGCTAGAGCTGGAGACACGGTCATATT
TACTGGAACTGTTGTTGCTGTTCCTGATGTTATGGCTCTAACTTCACCTGGTGAGAGAGC
AGAGTGTCGCCGGGAGGCTCCTCAGCGAAAGAATGGGTCTGGTGTCCAAGAAGGTGTCAA
GGGCTTGAAATCACTAGGAGTACGAGATCTGTCATATCGCCTTGCTTTTGTAGCAAACTC
AGTGCAGGTGGCGGATGGAAGGAGAGAAGTCGACATCCGGGACAGGGACATAGATGGAGA
TGACAGCGAAAGACAGAAGTTCACTGAAGAAGAGGAAGATGAAGTTGTTAGGATGAGGAA
CGTTCCTGATTTTTTCAATAAGATAGTTGATAGCATATGTCCCACTGTCTTTGGGCATCA
AGAAATTAAGAGAGCAATCCTTCTCATGCTTTTGGGTGGTGTTCACAAGATAACACATGA
AGGGATAAACCTTAGAGGTGACATCAATGTCTGTATTGTTGGTGATCCAAGTTGTGCGAA
GTCTCAGTTCTTAAAATATACCGCTGGTATTGTTCCACGATCTGTTTACACATCAGGGAA
GTCCTCATCTGCTGCTGGTTTGACAGCAACTGTTGCTAAAGAACCAGAGACTGGCGAATT
TTGCATTGAGGCAGGAGCACTCATGTTAGCTGATAATGGCATCTGCTGCATTGATGAATT
TGATAAAATGGACATCAAAGATCAGGTTGCTATACATGAAGCAATGGAACAGCAAACCAT
TAGCATAACAAAAGCAGGAATACAAGCAACTTTGAATGCAAGGACTTCAATTTTGGCAGC
AGCAAATCCCACAGGAGGGCGTTATGACAAGTCAAAACCACTCAAGTATAACGTGGCATT
GCCTCCAGCTATTCTTTCAAGATTTGATCTGGTATACATAATGATCGATGAGCCTGATGA
AAACACTGACTACCACATTGCTCATCACATTGTGAGGGTCCATCAGAAACGTGAAGAAGC
ACTTGCCCCTGCATTTAGCACGGCAGAATTGAAACGTTACATTGCTTTTGCGAAGTCCTT
GAAACCTCAGCTGAGTTCTGAAGCAAAGAAAGTTCTGGTTGAATCATATGTTACCCTTCG
TAGAGGAGATAGTACCCCTGGTACTAGGGTTGCTTATAGGATGACAGTTAGGCAACTAGA
GGCATTAATCAGGCTTTCAGAAGCTATTGCCCGAAGTCATTTGGAAAGAGTTGTTCTCCC
AGCCCATGTTCGCATGGCAGTTAAATTGCTCAAGACATCCATCATCAGCGTGGAATCAAG
TGAAGTTGATCTCTCTGATTTCCAAGATGCTGATGATGGCACAAATGTACCAGCCGATAA
TGATGCTGGTCAGCCAACAGAAATGGATGCTGCTCCTCAACAAGACGGTCCAGAAAATGA
GCAAGCGGCAGATACTGGTAAGAAGAAGTTGGTTATAACCGAAGAACATTTCCAGAGAGT
CACGCAAGCTTTAGTTATGAGACTACGGCAGCATGAAGAGTCTGTCACGAAAGATGGAGA
TGGTCTGGCTGGCATGAAGCAAGGGGATCTGATAATTTGGTATGTTGAGCAGCAGAATGC
CCAAGGAGCCTATAGTTCTACAGCAGAGGTGAAGGAAGAAGTGAAGTGCATCAAGGCCAT
CATAGAGAGGTTAATACAGAGGGATGGCCATCTCATAGTGATAGACGAAGGAGCAGCCCC
AGCGGCTGACGACGGTGCTGCACGAAGAACATCAGAGAGCAGAATCCTGGCAGTTAATCC
GAACTATGTCATCGATTAACCATCTGAATTATGATACGCAGCTAACACAATCCAATCGAT
GTGGTTAACCGATAGAACCAAGAGTAGATTCTAGTGAGAACCCCTGGTGGGTTATGCTAT
GCACTAGACATGTACCATTTCCAACTGTGGTAGTCTTTGCAATTGAGTATATGATCTCTT
GACAAATTGTACAATTAATTCTTGGAAGCAAAGGTGTAGTCAGAGTTATAGTTGATGATA
ACTATAATCGGTAGTGTGCCTGTGTACATTTTCTTAGAGTTGGTTGAACTATGTGAGGGC
TTTGGAGTTTGGAGAAGCTTGAATTTTCAAGTGCTTGCTGTGCTTCTAACGTGTATCATT
CAGATTCAGATGATTCGAGAAACGTACCTTTGGCT

CDS

2493 bp

>Os05t0235800-01 DNA-dependent ATPase MCM domain containing protein.
ATGGAGGCGTTCGGCGGGTTCTTCGTGGACGAGAAGGCGGCGCGGGTGGAGAACATCTTC
CTCGAGTTCCTCAGGCGGTTCAAGGAGGCGGATGCGGCGGAGGCGTTCTACGAGACGGAG
CTGGAGGCGATGCGGTCGCGGGAGTCCACCACCATGTACGTCGACTTCGCCCACGTCATG
CGATTCAACGACGTCCTCCAGAAGGCCATCTCCGAGGAGTATCTCAGGTTCGAGCCGTAC
CTCCGGAATGCGTGCAAGAGGTTTGTGATGGAGCAGAGGACTGGCGAGAACCGTGCACCA
ATCATCTCTGATGATAGCCCTAACAAGGACATTAACATTGCCTTCTACAACATACCAATG
CTGAAGAGGTTGAGGGAGCTTGGAACAGCAGAGATTGGTAAGCTCACGGCTGTAATGGGG
GTGGTTACACGGACAAGTGAGGTCCGGCCTGAGTTACTGCAAGGCACCTTCAAGTGCCTT
GACTGTGGAAATGTTGTAAAGAATGTTGAGCAGCAGTTCAAGTATACTGAGCCAATAATA
TGTGTCAATGCAACATGCCAAAATCGATCAAAATGGGCCCTTCTCCGACAAGAGAGCAAG
TTCACAGATTGGCAGCGGGTCAGGATGCAGGAGACATCAAAAGAAATACCTGCTGGTTCA
CTACCACGCTCCCTGGATGTCATTCTGAGGCATGAGATTGTTGAGAAGGCTAGAGCTGGA
GACACGGTCATATTTACTGGAACTGTTGTTGCTGTTCCTGATGTTATGGCTCTAACTTCA
CCTGGTGAGAGAGCAGAGTGTCGCCGGGAGGCTCCTCAGCGAAAGAATGGGTCTGGTGTC
CAAGAAGGTGTCAAGGGCTTGAAATCACTAGGAGTACGAGATCTGTCATATCGCCTTGCT
TTTGTAGCAAACTCAGTGCAGGTGGCGGATGGAAGGAGAGAAGTCGACATCCGGGACAGG
GACATAGATGGAGATGACAGCGAAAGACAGAAGTTCACTGAAGAAGAGGAAGATGAAGTT
GTTAGGATGAGGAACGTTCCTGATTTTTTCAATAAGATAGTTGATAGCATATGTCCCACT
GTCTTTGGGCATCAAGAAATTAAGAGAGCAATCCTTCTCATGCTTTTGGGTGGTGTTCAC
AAGATAACACATGAAGGGATAAACCTTAGAGGTGACATCAATGTCTGTATTGTTGGTGAT
CCAAGTTGTGCGAAGTCTCAGTTCTTAAAATATACCGCTGGTATTGTTCCACGATCTGTT
TACACATCAGGGAAGTCCTCATCTGCTGCTGGTTTGACAGCAACTGTTGCTAAAGAACCA
GAGACTGGCGAATTTTGCATTGAGGCAGGAGCACTCATGTTAGCTGATAATGGCATCTGC
TGCATTGATGAATTTGATAAAATGGACATCAAAGATCAGGTTGCTATACATGAAGCAATG
GAACAGCAAACCATTAGCATAACAAAAGCAGGAATACAAGCAACTTTGAATGCAAGGACT
TCAATTTTGGCAGCAGCAAATCCCACAGGAGGGCGTTATGACAAGTCAAAACCACTCAAG
TATAACGTGGCATTGCCTCCAGCTATTCTTTCAAGATTTGATCTGGTATACATAATGATC
GATGAGCCTGATGAAAACACTGACTACCACATTGCTCATCACATTGTGAGGGTCCATCAG
AAACGTGAAGAAGCACTTGCCCCTGCATTTAGCACGGCAGAATTGAAACGTTACATTGCT
TTTGCGAAGTCCTTGAAACCTCAGCTGAGTTCTGAAGCAAAGAAAGTTCTGGTTGAATCA
TATGTTACCCTTCGTAGAGGAGATAGTACCCCTGGTACTAGGGTTGCTTATAGGATGACA
GTTAGGCAACTAGAGGCATTAATCAGGCTTTCAGAAGCTATTGCCCGAAGTCATTTGGAA
AGAGTTGTTCTCCCAGCCCATGTTCGCATGGCAGTTAAATTGCTCAAGACATCCATCATC
AGCGTGGAATCAAGTGAAGTTGATCTCTCTGATTTCCAAGATGCTGATGATGGCACAAAT
GTACCAGCCGATAATGATGCTGGTCAGCCAACAGAAATGGATGCTGCTCCTCAACAAGAC
GGTCCAGAAAATGAGCAAGCGGCAGATACTGGTAAGAAGAAGTTGGTTATAACCGAAGAA
CATTTCCAGAGAGTCACGCAAGCTTTAGTTATGAGACTACGGCAGCATGAAGAGTCTGTC
ACGAAAGATGGAGATGGTCTGGCTGGCATGAAGCAAGGGGATCTGATAATTTGGTATGTT
GAGCAGCAGAATGCCCAAGGAGCCTATAGTTCTACAGCAGAGGTGAAGGAAGAAGTGAAG
TGCATCAAGGCCATCATAGAGAGGTTAATACAGAGGGATGGCCATCTCATAGTGATAGAC
GAAGGAGCAGCCCCAGCGGCTGACGACGGTGCTGCACGAAGAACATCAGAGAGCAGAATC
CTGGCAGTTAATCCGAACTATGTCATCGATTAA

Protein

831 aa

>Os05t0235800-01 DNA-dependent ATPase MCM domain containing protein.
MEAFGGFFVDEKAARVENIFLEFLRRFKEADAAEAFYETELEAMRSRESTTMYVDFAHVM
RFNDVLQKAISEEYLRFEPYLRNACKRFVMEQRTGENRAPIISDDSPNKDINIAFYNIPM
LKRLRELGTAEIGKLTAVMGVVTRTSEVRPELLQGTFKCLDCGNVVKNVEQQFKYTEPII
CVNATCQNRSKWALLRQESKFTDWQRVRMQETSKEIPAGSLPRSLDVILRHEIVEKARAG
DTVIFTGTVVAVPDVMALTSPGERAECRREAPQRKNGSGVQEGVKGLKSLGVRDLSYRLA
FVANSVQVADGRREVDIRDRDIDGDDSERQKFTEEEEDEVVRMRNVPDFFNKIVDSICPT
VFGHQEIKRAILLMLLGGVHKITHEGINLRGDINVCIVGDPSCAKSQFLKYTAGIVPRSV
YTSGKSSSAAGLTATVAKEPETGEFCIEAGALMLADNGICCIDEFDKMDIKDQVAIHEAM
EQQTISITKAGIQATLNARTSILAAANPTGGRYDKSKPLKYNVALPPAILSRFDLVYIMI
DEPDENTDYHIAHHIVRVHQKREEALAPAFSTAELKRYIAFAKSLKPQLSSEAKKVLVES
YVTLRRGDSTPGTRVAYRMTVRQLEALIRLSEAIARSHLERVVLPAHVRMAVKLLKTSII
SVESSEVDLSDFQDADDGTNVPADNDAGQPTEMDAAPQQDGPENEQAADTGKKKLVITEE
HFQRVTQALVMRLRQHEESVTKDGDGLAGMKQGDLIIWYVEQQNAQGAYSSTAEVKEEVK
CIKAIIERLIQRDGHLIVIDEGAAPAADDGAARRTSESRILAVNPNYVID*

5'UTR

chr05:8312907..8313012 (+ strand) : 106 bp

CDS

chr05:8313013..8313089 (+ strand) : 77 bp

chr05:8313209..8313358 (+ strand) : 150 bp

chr05:8313576..8313716 (+ strand) : 141 bp

chr05:8314023..8314185 (+ strand) : 163 bp

chr05:8314266..8314459 (+ strand) : 194 bp

chr05:8314539..8314734 (+ strand) : 196 bp

chr05:8314827..8314904 (+ strand) : 78 bp

chr05:8315298..8315527 (+ strand) : 230 bp

chr05:8315939..8316053 (+ strand) : 115 bp

chr05:8316243..8316317 (+ strand) : 75 bp

chr05:8316397..8316537 (+ strand) : 141 bp

chr05:8316674..8316877 (+ strand) : 204 bp

chr05:8316951..8317112 (+ strand) : 162 bp

chr05:8317328..8317380 (+ strand) : 53 bp

chr05:8317461..8317588 (+ strand) : 128 bp

chr05:8317681..8317803 (+ strand) : 123 bp

chr05:8318542..8318672 (+ strand) : 131 bp

chr05:8318892..8319023 (+ strand) : 132 bp

3'UTR

chr05:8319024..8319399 (+ strand) : 376 bp

FASTA

>Os05t0235800-01 class=Sequence position=chr05:8312907..8319399 (+ strand)
CTTGTTCCCC CAACCAAAAC CCTCGCGCCC CCGCCGCACC ACCCGCGCAG CCGCACAGCG CAAATCCCCC CCACCCCGCG
CAAGGTTTCG AGAGGTCTCG TCGGAGATGG AGGCGTTCGG CGGGTTCTTC GTGGACGAGA AGGCGGCGCG GGTGGAGAAC
ATCTTCCTCG AGTTCCTCAG GCGGTAAGGC CGGAGCCGTC TCCTTCCATT CCATTTCTAG GGTTTAAGCG GGGTTCCGGT
TCGTCTGACG CGTGAGGTGG GGGATTATTT TATTTTATTT TTGTTGAAAC TTGGATCTGT AGGTTCAAGG AGGCGGATGC
GGCGGAGGCG TTCTACGAGA CGGAGCTGGA GGCGATGCGG TCGCGGGAGT CCACCACCAT GTACGTCGAC TTCGCCCACG
TCATGCGATT CAACGACGTC CTCCAGAAGG CCATCTCCGA GGAGTATCTC AGGTGAGATT TGATTTGATT TGAAATTTTT
TTTTTGGTGG GGAGTTCAGA TTGGGAAATT TTGGGATCTG TCCCTGGATT TGCTCGGATT TGTTCAGAGA ACTCGGTTGA
TGTGTACTTA GCACAAATAG AATTTTTTTC CTAGAAAAAA TACAAATTAA TTTGCTCATC TGTGACGACA ATTTGGAACT
GACTGCTTAT GTGGATTTCA TTGCATCAGG TTCGAGCCGT ACCTCCGGAA TGCGTGCAAG AGGTTTGTGA TGGAGCAGAG
GACTGGCGAG AACCGTGCAC CAATCATCTC TGATGATAGC CCTAACAAGG ACATTAACAT TGCCTTCTAC AACATACCAA
TGCTGAAGAG GTCCGCACTT GCTCCTCCAG GTGTAACAGT TTTTTTTTCC CTGTAAAATT AACTCTGGAA ATAACAGTTA
TCTGACGGCA AATGAACGAA TTCTGCAAAT GTCCTGAAAT TCACTACAAA AGTGTGATAT ATACATATAT TCAAGGGTGG
GGCTCATTGC CCCTGGAATT TCATGTTAGT ACGTTTCCCA CATTTGGTAG AAAATTATGT CTCACTTTTT ATCTTGCATT
TCTAATTTGT CATAGGTTTT ATGCTAAATT GTATGATGGT TGCCATAACA ATTGACTTAA ATTGTTGTTG TAATAGGTTG
AGGGAGCTTG GAACAGCAGA GATTGGTAAG CTCACGGCTG TAATGGGGGT GGTTACACGG ACAAGTGAGG TCCGGCCTGA
GTTACTGCAA GGCACCTTCA AGTGCCTTGA CTGTGGAAAT GTTGTAAAGA ATGTTGAGCA GCAGTTCAAG TATACTGAGG
TTGTAACTGT GAACCTTATG TTCTACTTTT TTCTCTCATG CAATGTGTCT AATGAAAGGT TTCTGCTCCT TAACTTCAGC
CAATAATATG TGTCAATGCA ACATGCCAAA ATCGATCAAA ATGGGCCCTT CTCCGACAAG AGAGCAAGTT CACAGATTGG
CAGCGGGTCA GGATGCAGGA GACATCAAAA GAAATACCTG CTGGTTCACT ACCACGCTCC CTGGATGTCA TTCTGAGGCA
TGAGATTGTT GAGAAGGCTA GAGCTGGAGA CACGTGAGGA ACTCTTGCTG GAACTGCTTT GTACCCACTG GATTGGCTTC
ACATTAAAGT ATTCTGTTTC GGTCATTTTC AGGGTCATAT TTACTGGAAC TGTTGTTGCT GTTCCTGATG TTATGGCTCT
AACTTCACCT GGTGAGAGAG CAGAGTGTCG CCGGGAGGCT CCTCAGCGAA AGAATGGGTC TGGTGTCCAA GAAGGTGTCA
AGGGCTTGAA ATCACTAGGA GTACGAGATC TGTCATATCG CCTTGCTTTT GTAGCAAACT CAGTGCAGGT ATGACCTCTT
TCCAGCAATA AATATCGATC TGGTTAGCTT GGTTATAATA TTTTTATTAC AAGGTTAACC TTTCTCTTTA ATGTTATTAG
GTGGCGGATG GAAGGAGAGA AGTCGACATC CGGGACAGGG ACATAGATGG AGATGACAGC GAAAGACAGA AGTTCACTGT
AAGTTCAATT CAGACTCGAG ACTAGTTACT CTGTTTCGAA GAAGGAAAAG GGACTAGCCT TGTAAAAAGA ACTATGAGAA
ATTCTGTTTA CATGGTATTC GAACATTCTG TTGCATGCTA GCAGGCTGGC ATGGATAGGT GTAACCATAC CAGCATCCTT
TTTCTATTTT TTTGACAATG AGTATCATTC AAGCTCCCTA AACTTTTGCA TGATCCTGGT GCACTGTTGA TTTAGTGTGT
TACATATTCA TGTAAGGATG TTAGATCATG AAATGGTTAT CATTCCACTT TTTTGTTTTT GTGTATTATA TTCTTTATTT
TTGATCATAT AGTTTTTTGT CATCAAAGTG TTTATATTAT TAATTATCTC CCTCCCCCCT CTCTCTTACA GGAAGAAGAG
GAAGATGAAG TTGTTAGGAT GAGGAACGTT CCTGATTTTT TCAATAAGAT AGTTGATAGC ATATGTCCCA CTGTCTTTGG
GCATCAAGAA ATTAAGAGAG CAATCCTTCT CATGCTTTTG GGTGGTGTTC ACAAGATAAC ACATGAAGGG ATAAACCTTA
GAGGTGACAT CAATGTCTGT ATTGTTGGTG ATCCAAGTTG TGCGAAGTCT CAGTTCTTAA AGTAAGCTTC TCATTGTATT
CTCATTGTCA TGATTCTTAT TTTCTTTTTC TGTGATGAAT AAAATTTAAG TTCCATCATT CAATGTTGTC ATTCTGGGAT
ATATAAAATC TATTCTGCTG CTTCACCAGA TCATATGTTA GTGTGCATAA ACGACCATTG CTTTCTGATA AGGGTCCCTC
AGCATGATGC AATACATCTT GATTAGTCTA CTAGTTGAAT TTAAGTTACT ATAAGCTTTT TAACAATGTT TTTCTGAATG
ATATTTATGG GTTGACAACT TGACATAAAA TCCAGAAGTT GCTCATGTAA TTTTGTTCTT GGATTGGACT TCCTATCTTG
TTATAAGTTC CATTCATCTT AATGAAATTT ATTCATGAAT CATCACAAAT GTGCTATTAA TCCAATCCTC AGATATACCG
CTGGTATTGT TCCACGATCT GTTTACACAT CAGGGAAGTC CTCATCTGCT GCTGGTTTGA CAGCAACTGT TGCTAAAGAA
CCAGAGACTG GCGAATTTTG CATTGAGGTA TTATCAAAAT TTTGCGATTC CATCCATTTG TATTGCTAAT ACATATTTAG
AAGTGCACCT TTGCTTTGAA TTGCATGCTT CAACTAAATT GAACTCCAAT GAGCTTGGAT GCACTTTGTG TGCAATCTTC
CTAGTTCTTC TGTTCTATTG CCTTACCTCC TCTGCTGCTA CTGGTTATTT TTGCAGGCAG GAGCACTCAT GTTAGCTGAT
AATGGCATCT GCTGCATTGA TGAATTTGAT AAAATGGACA TCAAAGATCA GGTAGGCTTG CCGACTTTTA CCTATTGTTG
CCTCTTTTCT TATTGAACGT GAGTGTCCCA ATTTCATTTC TCCATTGTAG GTTGCTATAC ATGAAGCAAT GGAACAGCAA
ACCATTAGCA TAACAAAAGC AGGAATACAA GCAACTTTGA ATGCAAGGAC TTCAATTTTG GCAGCAGCAA ATCCCACAGG
AGGGCGTTAT GACAAGTCAA AACCACTCAA GGTAAGCCTA ACAAATTATA AAAAATTGTA CTTCCAAGTA CTTCTGAAAA
ACTTTTGCAT CCCTGTATTT TGTTGACATG TTGTGGTAAA ATTTCAGTGC TGAGATCTAA TATTTCAATC GTTGCAATCC
TTATCAGTAT AACGTGGCAT TGCCTCCAGC TATTCTTTCA AGATTTGATC TGGTATACAT AATGATCGAT GAGCCTGATG
AAAACACTGA CTACCACATT GCTCATCACA TTGTGAGGGT CCATCAGAAA CGTGAAGAAG CACTTGCCCC TGCATTTAGC
ACGGCAGAAT TGAAACGTTA CATTGCTTTT GCGAAGTCCT TGAAACCTCA GGTTTATATC TTTATGCACT TCATATATAA
CTTTCAACTT GTCATCAACT TATAGATGCT TTATGTCAAT GCAGCTGAGT TCTGAAGCAA AGAAAGTTCT GGTTGAATCA
TATGTTACCC TTCGTAGAGG AGATAGTACC CCTGGTACTA GGGTTGCTTA TAGGATGACA GTTAGGCAAC TAGAGGCATT
AATCAGGCTT TCAGAAGCTA TTGCCCGAAG TCATTTGGAA AGAGTTGTAA GTAAAATCCT CATTCATATA TTGCATGTTT
TTTAGATTAT GCAGTATGGT GTCTAAATAA ATTAACTTAA GTTCAACAAT CAGGAATAGT ATTATTAGTT GGTTGTGGTG
TTAAATTTAA AAGGCTGACA TTTGTTCCCT CCCTTTGCAT TGGGGTTTTT CACCTTACGG CATAATATTT CTGCTGACTT
CATTTGGGAT TAATTTCACA GGTTCTCCCA GCCCATGTTC GCATGGCAGT TAAATTGCTC AAGACATCCA TCATCAGGCA
AGTTTCTTGA AATTGCTCAA GACATCCATC CATCATTTGC ATGATGATTT GCTAACAAAA TCTTATTAAT TGTGCAGCGT
GGAATCAAGT GAAGTTGATC TCTCTGATTT CCAAGATGCT GATGATGGCA CAAATGTACC AGCCGATAAT GATGCTGGTC
AGCCAACAGA AATGGATGCT GCTCCTCAAC AAGACGGTCC AGGTAGGTTT CCCCTTATTA TTAAAATGGC TTTTTTGTGT
GTTCTTGCTA TTATTCTGAT CATTCCGGTA CCTTGTTTTT AATGTAAAAT GTAGAAAATG AGCAAGCGGC AGATACTGGT
AAGAAGAAGT TGGTTATAAC CGAAGAACAT TTCCAGAGAG TCACGCAAGC TTTAGTTATG AGACTACGGC AGCATGAAGA
GTCTGTCACG AAAGATGGTA TTGATACTGG ATTTTACACT ACCTTTCCAT TTGTTTTGTT TTGACTTATT CGCTATTTTG
TATCCTTACC CTAGCAATTT CCAACTGTAG AAGAAGCATA GTAATATCTG CTTAGGTTCA AATAAGTGAA TTAATTTTTA
CTGCTTATGT CCCATATAAG GAGTAACAAG ATCCTTAGTT GTGATTTACT TACATAATTA TGAGCAGCAT TTCTGAGACA
TGCTTTCTCT CGAGAACAAA TGAAATTACG ATCTCGTCTA GATTACAGCT TCCAGAGGTC TAGGTTGGCG AGCAATTCTT
TTTAATTGCG TAAATTAATA AATCCTTTGT TTATATTCTA GAAAAACATA ATTTGCAATA ATTGTCTAGT ACTATTGTAT
TGCTTTAGCT TTTGTTCTTC TCTTACATCT TACTAGAAAG ATATATGCAT CTTCTTAAAA TTGATGTGGA GCCTCATGCA
GGCTTGTAGA TGCATCAATG TGATTAACTT GTACGCCAAC CATTTATACA GTGTAGTAAG CATAAATTGT AGTTATGTCT
ATTCAGGTTT CACCATGTTG ATGTCTCGTT ATATTGTTAG GACTTAATGC TATCTAATTC CGCTCCTGTA TAAGTCATTG
CTTTTAGTTC ATCTTGTGCC GCCCTAAGTG TTTCCTTTTA TGAACAAGGA TGATCCTTGT CAGACCTCCA GCTGATATAG
ATGTCAAACT GACATGTTCC AACATTGAAT TGCAGGAGAT GGTCTGGCTG GCATGAAGCA AGGGGATCTG ATAATTTGGT
ATGTTGAGCA GCAGAATGCC CAAGGAGCCT ATAGTTCTAC AGCAGAGGTG AAGGAAGAAG TGAAGTGCAT CAAGGCCATC
ATAGAGGTAA AAGCCTTCAT TGATCTTATC ATCTATGTAT CAATTTGCCT GCATTGATCC TATCAGTTCA ACAGTATGGT
ATGGAAATTA ACCTAACAAG ACTACATTTA AGGCATTTAG CTGCATCAAT TTGCCTGCAC TGCAAGCTCA ACATTGACCA
TTTATATTGA GCATTACCTC AGCTTTCCAT GTTGCTAAAA GTTATCAATC GATTTGCAAA TGCAGAGGTT AATACAGAGG
GATGGCCATC TCATAGTGAT AGACGAAGGA GCAGCCCCAG CGGCTGACGA CGGTGCTGCA CGAAGAACAT CAGAGAGCAG
AATCCTGGCA GTTAATCCGA ACTATGTCAT CGATTAACCA TCTGAATTAT GATACGCAGC TAACACAATC CAATCGATGT
GGTTAACCGA TAGAACCAAG AGTAGATTCT AGTGAGAACC CCTGGTGGGT TATGCTATGC ACTAGACATG TACCATTTCC
AACTGTGGTA GTCTTTGCAA TTGAGTATAT GATCTCTTGA CAAATTGTAC AATTAATTCT TGGAAGCAAA GGTGTAGTCA
GAGTTATAGT TGATGATAAC TATAATCGGT AGTGTGCCTG TGTACATTTT CTTAGAGTTG GTTGAACTAT GTGAGGGCTT
TGGAGTTTGG AGAAGCTTGA ATTTTCAAGT GCTTGCTGTG CTTCTAACGT GTATCATTCA GATTCAGATG ATTCGAGAAA
CGTACCTTTG GCT

Locus: Os05g0235800

Loading...

Locus: Os05g0235800

Loading...