Os05t0247100-01

Locus

Os05g0247100

Description

Similar to Glycosyl hydrolases family 18.

RAP-DB Gene Symbol Synonym(s)

DIP3, XIP, OsHI-XIP

RAP-DB Gene Name Synonym(s)

drought-induced protein 3, Xylanase inhibitor protein 2

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

DIP3, XIP, OsHI-XIP

Oryzabase Gene Name Synonym(s)

drought-induced protein 3, Xylanase inhibitor protein 2

Transcript Evidence

AK065866 (DDBJ, Best hit)

Protein Evidence

Q53NM2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: carbohydrate metabolic process (GO:0005975)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: cation binding (GO:0043169)

Functional domain (InterPro)

Glycoside hydrolase, subgroup, catalytic domain (IPR013781)

Glycoside hydrolase, superfamily (IPR017853)

Full-length cDNA

J013045O11 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0247100-01)

Others

Oryzabase (17792)

Transcript

1197 bp

>Os05t0247100-01 Similar to Glycosyl hydrolases family 18.
GCATCACAATCGATAGGTAGCTAACTACTCCATCTAGCTAAGACCCGTAGTGTATAGTAG
TCAAGATCAATGGCGTCCCGACGCCTTGCCCCGCTGCTGGTCCTACTGCTCTCGTCCAGC
CTCGCCGCCGGCCAGAGCACcggcgacaccgtcgtgttctggggccggaacacggaccag
ctcgaggggtccctccgtgaggcgtgcgacaccggcctctacaccaccgtcatcatctcc
ttcctcagcgccttcggctacatcccgggcacctacaagctggacatctccggccacacc
gtctccgccgtcggccccgacatcaagcactgccagtccaggggcatcctcgtcctcctc
gccatcggcggccagggcggcgagtactccctgccgacctcccaggcggccgtcgacctc
gaggactacctctggaacgccttcctcggcggcggccgccccggcgtcgcccgccccttc
ggcgacgccgtcgtcgacggcatcgacttcttcatcgaccagggcgccacggagcactac
gacgagctggctgcaggcggcgctgtccacggggctcttctcgcggatccacgtcaaggt
gttcggcgacgggcggtgcgcgtcgaggagggaggagctggagaagtggatggcggcgta
cccgcagagccgcgtcctcgtcggcgtcgtcgcgtcgccggaggctgacagggacggcta
cgtgtcgcacaaggatctctactacgacgtgctgcagttcatcaacaagctgcccaacta
tgggggcatcatggtctggaacaggtactgggacAAGAAGACCGGATGGACGGCTGGTAA
TGAGCCTGGTCTCCTGGATCAGGTTCTGTGATGGACGGCTGGTAATTAACCAGACCTTGA
TCCATTTTCACTTTGATCACTGATCACTTCACTGGATTCATGCACGAGCTACTACTAGTA
CGTGCACAAATAAAGTAAGTAATGTCATGTGACGTGCATGCACAAATAAAGATGGAAATG
ATATGATAAAAGATTGGGGTATGTGTGTGTGTGTGTGTTGGATAATGTAATGTAATGCAC
AAATAAAGTGAGGTGATCAGGACGGGCAGGCTTACTTTCTTCTGGGTGATATGTTGTATG
TATTTTGTTTTATTGGATTGGAATAAATATATATATATATATATATATTTCATCGCC

CDS

639 bp

>Os05t0247100-01 Similar to Glycosyl hydrolases family 18.
ATGGCGTCCCGACGCCTTGCCCCGCTGCTGGTCCTACTGCTCTCGTCCAGCCTCGCCGCC
GGCCAGAGCACcggcgacaccgtcgtgttctggggccggaacacggaccagctcgagggg
tccctccgtgaggcgtgcgacaccggcctctacaccaccgtcatcatctccttcctcagc
gccttcggctacatcccgggcacctacaagctggacatctccggccacaccgtctccgcc
gtcggccccgacatcaagcactgccagtccaggggcatcctcgtcctcctcgccatcggc
ggccagggcggcgagtactccctgccgacctcccaggcggccgtcgacctcgaggactac
ctctggaacgccttcctcggcggcggccgccccggcgtcgcccgccccttcggcgacgcc
gtcgtcgacggcatcgacttcttcatcgaccagggcgccacggagcactacgacgagctg
gctgcaggcggcgctgtccacggggctcttctcgcggatccacgtcaaggtgttcggcga
cgggcggtgcgcgtcgaggagggaggagctggagaagtggatggcggcgtacccgcagag
ccgcgtcctcgtcggcgtcgtcgcgtcgccggaggctga

Protein

213 aa

>Os05t0247100-01 Similar to Glycosyl hydrolases family 18.
MASRRLAPLLVLLLSSSLAAGQSTGDTVVFWGRNTDQLEGSLREACDTGLYTTVIISFLS
AFGYIPGTYKLDISGHTVSAVGPDIKHCQSRGILVLLAIGGQGGEYSLPTSQAAVDLEDY
LWNAFLGGGRPGVARPFGDAVVDGIDFFIDQGATEHYDELAAGGAVHGALLADPRQGVRR
RAVRVEEGGAGEVDGGVPAEPRPRRRRRVAGG*

5'UTR

chr05:8903721..8903789 (- strand) : 69 bp

CDS

chr05:8903239..8903720 (- strand) : 482 bp

chr05:8902990..8903146 (- strand) : 157 bp

3'UTR

chr05:8902501..8902989 (- strand) : 489 bp

FASTA

>Os05t0247100-01 class=Sequence position=chr05:8902501..8903789 (- strand)
GCATCACAAT CGATAGGTAG CTAACTACTC CATCTAGCTA AGACCCGTAG TGTATAGTAG TCAAGATCAA TGGCGTCCCG
ACGCCTTGCC CCGCTGCTGG TCCTACTGCT CTCGTCCAGC CTCGCCGCCG GCCAGAGCAC cggcgacacc gtcgtgttct
ggggccggaa cacggaccag ctcgaggggt ccctccgtga ggcgtgcgac accggcctct acaccaccgt catcatctcc
ttcctcagcg ccttcggcta catcccgggc acctacaagc tggacatctc cggccacacc gtctccgccg tcggccccga
catcaagcac tgccagtcca ggggcatcct cgtcctcctc gccatcggcg gccagggcgg cgagtactcc ctgccgacct
cccaggcggc cgtcgacctc gaggactacc tctggaacgc cttcctcggc ggcggccgcc ccggcgtcgc ccgccccttc
ggcgacgccg tcgtcgacgg catcgacttc ttcatcgacc agggcgccac ggagcactac gacgagctgg cgcggcggct
gtacgcgcac aacaaggact acaaggggag gctcggggtg atgctgacgg cgacggcgag gtgcgtgttc ccggaccagc
ggctgcaggc ggcgctgtcc acggggctct tctcgcggat ccacgtcaag gtgttcggcg acgggcggtg cgcgtcgagg
agggaggagc tggagaagtg gatggcggcg tacccgcaga gccgcgtcct cgtcggcgtc gtcgcgtcgc cggaggctga
cagggacggc tacgtgtcgc acaaggatct ctactacgac gtgctgcagt tcatcaacaa gctgcccaac tatgggggca
tcatggtctg gaacaggtac tgggacAAGA AGACCGGATG GACGGCTGGT AATGAGCCTG GTCTCCTGGA TCAGGTTCTG
TGATGGACGG CTGGTAATTA ACCAGACCTT GATCCATTTT CACTTTGATC ACTGATCACT TCACTGGATT CATGCACGAG
CTACTACTAG TACGTGCACA AATAAAGTAA GTAATGTCAT GTGACGTGCA TGCACAAATA AAGATGGAAA TGATATGATA
AAAGATTGGG GTATGTGTGT GTGTGTGTGT TGGATAATGT AATGTAATGC ACAAATAAAG TGAGGTGATC AGGACGGGCA
GGCTTACTTT CTTCTGGGTG ATATGTTGTA TGTATTTTGT TTTATTGGAT TGGAATAAAT ATATATATAT ATATATATAT
TTCATCGCC