Os05t0247100-02

Locus

Os05g0247100

Description

Chitinase III protein, Xylanase inhibitor, Regulation of abiotic stress response, Resistance to herbivores

RAP-DB Gene Symbol Synonym(s)

DIP3, XIP, OsHI-XIP

RAP-DB Gene Name Synonym(s)

drought-induced protein 3, Xylanase inhibitor protein 2

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

DIP3, XIP, OsHI-XIP

Oryzabase Gene Name Synonym(s)

drought-induced protein 3, Xylanase inhibitor protein 2

Transcript Evidence

AK062114

JQ218437

Protein Evidence

Q5WMX0

Literature

PMID: 24391034

DOI: 10.1007/s11105-013-0661-5

Note

Manual Curation

January 20, 2017

Gene Ontology (GO)

Biological Process: carbohydrate metabolic process (GO:0005975)

Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds (GO:0004553)

Functional domain (InterPro)

Glycoside hydrolase superfamily (IPR017853)

Glycoside hydrolase, catalytic domain (IPR013781)

Glycoside hydrolase family 18, catalytic domain (IPR001223)

Full-length cDNA

001-045-C02 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0247100-02)

RiceXPro (AK062114)

Others

Oryzabase (17792)

KEGG (Os05t0247100-02 (EC:3.2.1.14))

Transcript

1199 bp

>Os05t0247100-02 Chitinase III protein, Xylanase inhibitor, Regulation of abiotic stress response, Resistance to herbivores
GCATCACAATCGATAGGTAGCTAACTACTCCATCTAGCTAAGACCCGTAGTGTATAGTAG
TCAAGATCAATGGCGTCCCGACGCCTTGCCCCGCTGCTGGTCCTACTGCTCTCGTCCAGC
CTCGCCGCCGGCCAGAGCACcggcgacaccgtcgtgttctggggccggaacacggaccag
ctcgaggggtccctccgtgaggcgtgcgacaccggcctctacaccaccgtcatcatctcc
ttcctcagcgccttcggctacatcccgggcacctacaagctggacatctccggccacacc
gtctccgccgtcggccccgacatcaagcactgccagtccaggggcatcctcgtcctcctc
gccatcggcggccagggcggcgagtactccctgccgacctcccaggcggccgtcgacctc
gaggactacctctggaacgccttcctcggcggcggccgccccggcgtcgcccgccccttc
ggcgacgccgtcgtcgacggcatcgacttcttcatcgaccagggcgccacggagcactac
gacgagctggcgcggcggctgtacgcgcacaacaaggactacaaggggaggctcggggtg
atgctgacggcgacggcgaggtgcgtgttcccggaccagcggctgcaggcggcgctgtcc
acggggctcttctcgcggatccacgtcaaggtgttcggcgacgggcggtgcgcgtcgagg
agggaggagctggagaagtggatggcggcgtacccgcagagccgcgtcctcgtcggcgtc
gtcgcgtcgccggaggctgacagggacggctacgtgtcgcacaaggatctctactacgac
gtgctgcagttcatcaacaagctgcccaactatgggggcatcatggtctggaacaggtac
tgggacAAGAAGACCGGATGGACGGCTGGTAATGAGCCTGGTCTCCTGGATCAGGTTCTG
TGATGGACGGCTGGTAATTAACCAGACCTTGATCCATTTTCACTTTGATCACTGATCACT
TCACTGGATTCATGCACGAGCTACTACTAGTACGTGCACAAATAAAGTAAGTAATGTCAT
GTGACGTGCATGCACAAATAAAGATGGAAATGATATGATAAAAGATTGGGGTATGTGTGT
GTGTGTGTGTTGGATAATGTAATGTAATGCACAAATAAAGTGAGGTGATCAGGACGGGC

CDS

894 bp

>Os05t0247100-02 Chitinase III protein, Xylanase inhibitor, Regulation of abiotic stress response, Resistance to herbivores
ATGGCGTCCCGACGCCTTGCCCCGCTGCTGGTCCTACTGCTCTCGTCCAGCCTCGCCGCC
GGCCAGAGCACcggcgacaccgtcgtgttctggggccggaacacggaccagctcgagggg
tccctccgtgaggcgtgcgacaccggcctctacaccaccgtcatcatctccttcctcagc
gccttcggctacatcccgggcacctacaagctggacatctccggccacaccgtctccgcc
gtcggccccgacatcaagcactgccagtccaggggcatcctcgtcctcctcgccatcggc
ggccagggcggcgagtactccctgccgacctcccaggcggccgtcgacctcgaggactac
ctctggaacgccttcctcggcggcggccgccccggcgtcgcccgccccttcggcgacgcc
gtcgtcgacggcatcgacttcttcatcgaccagggcgccacggagcactacgacgagctg
gcgcggcggctgtacgcgcacaacaaggactacaaggggaggctcggggtgatgctgacg
gcgacggcgaggtgcgtgttcccggaccagcggctgcaggcggcgctgtccacggggctc
ttctcgcggatccacgtcaaggtgttcggcgacgggcggtgcgcgtcgaggagggaggag
ctggagaagtggatggcggcgtacccgcagagccgcgtcctcgtcggcgtcgtcgcgtcg
ccggaggctgacagggacggctacgtgtcgcacaaggatctctactacgacgtgctgcag
ttcatcaacaagctgcccaactatgggggcatcatggtctggaacaggtactgggacAAG
AAGACCGGATGGACGGCTGGTAATGAGCCTGGTCTCCTGGATCAGGTTCTGTGA

Protein

298 aa

>Os05t0247100-02 Chitinase III protein, Xylanase inhibitor, Regulation of abiotic stress response, Resistance to herbivores
MASRRLAPLLVLLLSSSLAAGQSTGDTVVFWGRNTDQLEGSLREACDTGLYTTVIISFLS
AFGYIPGTYKLDISGHTVSAVGPDIKHCQSRGILVLLAIGGQGGEYSLPTSQAAVDLEDY
LWNAFLGGGRPGVARPFGDAVVDGIDFFIDQGATEHYDELARRLYAHNKDYKGRLGVMLT
ATARCVFPDQRLQAALSTGLFSRIHVKVFGDGRCASRREELEKWMAAYPQSRVLVGVVAS
PEADRDGYVSHKDLYYDVLQFINKLPNYGGIMVWNRYWDKKTGWTAGNEPGLLDQVL*

5'UTR

chr05:8903721..8903789 (- strand) : 69 bp

CDS

chr05:8902827..8903720 (- strand) : 894 bp

3'UTR

chr05:8902591..8902826 (- strand) : 236 bp

FASTA

>Os05t0247100-02 class=Sequence position=chr05:8902591..8903789 (- strand)
GCATCACAAT CGATAGGTAG CTAACTACTC CATCTAGCTA AGACCCGTAG TGTATAGTAG TCAAGATCAA TGGCGTCCCG
ACGCCTTGCC CCGCTGCTGG TCCTACTGCT CTCGTCCAGC CTCGCCGCCG GCCAGAGCAC cggcgacacc gtcgtgttct
ggggccggaa cacggaccag ctcgaggggt ccctccgtga ggcgtgcgac accggcctct acaccaccgt catcatctcc
ttcctcagcg ccttcggcta catcccgggc acctacaagc tggacatctc cggccacacc gtctccgccg tcggccccga
catcaagcac tgccagtcca ggggcatcct cgtcctcctc gccatcggcg gccagggcgg cgagtactcc ctgccgacct
cccaggcggc cgtcgacctc gaggactacc tctggaacgc cttcctcggc ggcggccgcc ccggcgtcgc ccgccccttc
ggcgacgccg tcgtcgacgg catcgacttc ttcatcgacc agggcgccac ggagcactac gacgagctgg cgcggcggct
gtacgcgcac aacaaggact acaaggggag gctcggggtg atgctgacgg cgacggcgag gtgcgtgttc ccggaccagc
ggctgcaggc ggcgctgtcc acggggctct tctcgcggat ccacgtcaag gtgttcggcg acgggcggtg cgcgtcgagg
agggaggagc tggagaagtg gatggcggcg tacccgcaga gccgcgtcct cgtcggcgtc gtcgcgtcgc cggaggctga
cagggacggc tacgtgtcgc acaaggatct ctactacgac gtgctgcagt tcatcaacaa gctgcccaac tatgggggca
tcatggtctg gaacaggtac tgggacAAGA AGACCGGATG GACGGCTGGT AATGAGCCTG GTCTCCTGGA TCAGGTTCTG
TGATGGACGG CTGGTAATTA ACCAGACCTT GATCCATTTT CACTTTGATC ACTGATCACT TCACTGGATT CATGCACGAG
CTACTACTAG TACGTGCACA AATAAAGTAA GTAATGTCAT GTGACGTGCA TGCACAAATA AAGATGGAAA TGATATGATA
AAAGATTGGG GTATGTGTGT GTGTGTGTGT TGGATAATGT AATGTAATGC ACAAATAAAG TGAGGTGATC AGGACGGGC